KEGG   Salvelinus alpinus (Arctic char): 111961521Help
Entry
111961521         CDS       T05762                                 

Definition
(RefSeq) cytosolic purine 5'-nucleotidase-like isoform X1
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00230  Purine metabolism
salp00240  Pyrimidine metabolism
salp00760  Nicotinate and nicotinamide metabolism
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111961521
   00240 Pyrimidine metabolism
    111961521
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    111961521
Enzymes [BR:salp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     111961521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid
Motif
Other DBs
NCBI-GeneID: 111961521
NCBI-ProteinID: XP_023839621
AA seq 545 aa AA seqDB search
MSDLTIPLSGEAVTATTMEDPTRIVTDQPTKSDTDQSISPDVPLVKNMEYQHKVFVNRSV
PLENIKCYGFDMDYTLAEYKSPDYEDLGFELLRDRLVSIGYPHELLHYTYDPTFPTRGLV
FDTMYGNLLKVDSNGNILLCSHGFTFLKRDKIQDYYPNNFIQRGNTDRFYILSTLFNLSE
TYLDGCLVDLFTRCSRYENCQKGFKHGDLFMSFRSMFQDVRDAMDYVHDTGSLKESTLRN
LDKYVVRDLNLPVLLTRIKEVAKVFLATNSDYNYTEAIMKYLLETPPGAKYPKKTWRAFF
DLVVVDTRKPLFFAEGTVLRQVDTNTGKLRIGTYTGDLQHGTVYSGGSSDIVCDLLDVKG
KDILYVGDHIFGDILKSKKRQGWKTFLVVPELAKELQVWTEKNHLFEELKHLDIFLAELY
KHLDSSCRECPDITAIQTRMKVVTYRMDLSYGQMGSLLRSGSRQTLFASQLMRYADLYSS
TCINLLHYPFSYLFRAPPVLMPHESSVDNHPLDFPSPQFSVLDQIQKIAEAKRASEDNTA
ELKDT
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatctcactatccccctatctggagaggctgttacagcgacgactatggaggat
ccgactcggattgtgacagatcaacctactaaatctgatacagaccagagcatttcaccc
gatgtgcccttggtgaagaacatggaatatcagcacaaggtgtttgtcaataggagtgta
ccattggagaacatcaaatgctatggctttgacatggactacactctggcagagtacaag
tctcctgactacgaggacctgggctttgagctgctcagagacaggctggtgtctataggc
tatccccatgagctactgcattacacctacgaccccaccttccccacacgcggcctggtg
tttgacacaatgtatggtaacttgctgaaggtggactccaatggaaacattctgctgtgc
agtcatggtttcacctttctaaaaagggacaagatccaagactactaccccaacaacttc
attcagagaggcaacactgaccgcttctatatcctcagtactctcttcaacctttcagag
acgtatctggatggttgccttgtggacctcttcaccagatgcagcagatacgaaaactgc
cagaaaggcttcaaacatggtgacttgttcatgtccttcagaagcatgttccaggatgtc
cgagatgcaatggactatgttcatgatacgggcagtctgaaggaaagcactctgaggaat
ttggataaatatgtcgtcagagacctaaacttgcctgttctcctgactcgtattaaggag
gtggccaaagtgttcctggcgaccaacagtgattacaactacacggaggctatcatgaaa
tacttgcttgaaactccaccaggtgccaagtaccccaaaaaaacgtggcgcgccttcttt
gaccttgtcgtcgtggataccaggaagccactgttctttgccgagggaactgtgctgaga
caagtggacacgaacacagggaagctccgtattggaacatacactggagacctccagcat
ggaactgtctactctggcggctcctcagacattgtatgtgacctgctggacgtgaagggg
aaggacattctctatgtgggtgaccacatctttggggacatcctaaagtctaagaagagg
caaggttggaagaccttcctggtggtgcctgagctggccaaagagctgcaggtgtggaca
gagaagaaccatctctttgaagagctgaagcatcttgatatatttttagctgagttgtac
aagcacctggacagtagctgtagagagtgcccagacatcactgccattcagaccaggatg
aaggtggtgacctataggatggatctgtcctatgggcagatgggcagcctgctgcggagt
ggctccagacagactctgtttgccagccagctcatgcgttacgctgacctgtactcttcc
acctgcatcaatctgctccactaccccttcagttacctgttcagagccccacctgtcctg
atgccccatgagtcctcggtggataatcacccccttgacttcccttcacctcaattctct
gttctggaccaaatccagaagatagctgaagccaagagggcgagtgaggataacacagcg
gaactgaaagacacgtga

DBGET integrated database retrieval system