KEGG   Salvelinus alpinus (Arctic char): 111961824
Entry
111961824         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00230  Purine metabolism
salp00240  Pyrimidine metabolism
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111961824
   00240 Pyrimidine metabolism
    111961824
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     111961824
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 Thymidylate_kin AAA_17
Other DBs
NCBI-GeneID: 111961824
NCBI-ProteinID: XP_023840155
AA seq 262 aa
MSPTPPKRAGPSLLNDTMDKTKRISIEGNIAAGKSTFVRLLEEQSKDWEVVPEPIARWCD
VQTQHSEFEELTVSQKSGGNVLQMMYEKPERWAYTFQTYACMSRVRAQMKSTHGKLREAE
NPVQFFERSVYSDRYIFAANLYESECLNETEWSIYQDWHGWLHKQFGKHIELDGIIYLRA
APERCMERLHRRGREEEQGIPLEYLEKLHFKHESWLQHKTMCYKYLNNVPXLTLDVNEDF
QELTRSRVRTWVEKVKEFLSTL
NT seq 789 nt   +upstreamnt  +downstreamnt
atgtctcccacgccgccgaagagagcaggtcctagtctcttaaacgacactatggacaag
acaaaacgaatttcaatagaaggcaacattgcggcgggcaaatctacattcgtgcgcctt
ctggaagagcagagcaaagactgggaagtagtgcccgaacccatcgccaggtggtgcgat
gtacaaacacaacacagcgagtttgaggagctgaccgtgtcccagaagagtggtggtaac
gtgctgcagatgatgtatgagaagccagagagatgggcctacaccttccagacctacgct
tgcatgagcagggtccgcgcccagatgaaatccacccatgggaagctcagagaggcagag
aacccagtgcagttcttcgagcgctccgtctacagtgacaggtacatctttgcggcaaac
ctgtatgagagtgagtgtctgaacgagacagagtggtccatctaccaggactggcacggc
tggctccataaacagtttggaaaacacatcgagctggatggcatcatctacctccgagcc
gcaccagagagatgcatggagaggctgcatcggagaggcagagaggaggagcagggcatt
ccactggagtacctggagaaacttcacttcaaacacgagagctggctgcagcacaaaacc
atgtgttataagtatttgaataacgtgccanttctgacgctagatgttaacgaagatttc
caagagttgacaaggtcaagggtgcggacatgggtggaaaaggtcaaagagtttctcagt
accttgtaa

DBGET integrated database retrieval system