KEGG   Salvelinus alpinus (Arctic char): 111962118Help
Entry
111962118         CDS       T05762                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00562  Inositol phosphate metabolism
salp01100  Metabolic pathways
salp04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111962118
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    111962118
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     111962118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 111962118
NCBI-ProteinID: XP_023840720
AA seq 1728 aa AA seqDB search
MAQISSGNGFKLDVAQPKGVVGKEEALRMEAEALAKLQMEKRQTLPATSSSTSSSASSQN
KLHPAAAPRPTPSSSNRPEKDLIVFPEAKTQAEKDKFRDIDVDKLTNQELEKLLLDDSFG
ANSSKASRPSLLLGFNLSASYPGGYATCSPSPFHRGQWTPSMLSTPSSSGVSTPTHQQAP
MFPSAPFPNPENFSFHNGFSPAMPPYIGLPGPQTSFMAFTPIQQPGAMVFQQPTVTLEMA
KLFDKIHSTSEYLKNGRSASTDLDSSSTSVASLAPNPPQPAVESPAFSRFEWLDLDPLNK
RKAEGEEGSSLASRGTVMVVGGPAGGDPWDAVLLDETEGVAGGSSPPVEVTGQLAGRSQP
RRSSTGAAVTRNHSLTIPASSSQQKPNNQHDKGSGKALAKYTALEEKEAQNLEVVAFCED
VAILRSKFAHDDLHTNPGYVLSAVIPQRDGGGDNGCSVKVSIEISESQEPVTFTCDVSSP
VELLIMQALCWVHDDLNQVDIGSYVLKVCGQEEVLQNKHSLGSHEYVQNCRKWEAEIKLQ
LLSQSTMRRDLARTAEDDTSQVDLERHLGQVERPFKENVTRQGLADYLEGYHNQVNICLQ
NESTQYKTVDRVVQTVKNLCCALDEVETQAITEAVRRVKHSVNLPRTRSPEVGSKSSANG
HLSPVEECMGFLTDAVYDLAKLYLRSFCPAASSTSSPDPSSNSQHVEGESAAEGRGSKEA
SGTTDHLQFTLFAMHGIPAVWVSSYEKYYLMCALTHNGRNLFKPIQSKKVATYKSFFYHI
KWDEMINFPMAVALLPLESMLTLSLFGVLNQNASGSPDSNKQHKGPEVLGKVSLPLFDFR
RVLARGTKLLCLWTSSQAASAAAGIRRKNLAERIILQVDFPSPVVDVLYVGPQESPCPDP
NTLEELDPDLRRRVEKLCSRASTFGLTRADRQLLWDQRHHCRAHTHSLPKVLASAPSWDW
GSIAEIHALLHNWPSLQPVCALELLDSKFADTEVRSVAVSWIESSSDDELADYLPQLVQA
LKFECHLNNALVIFLLSRAQGNVNITLYLYWLLRDAVQDPAFGRRYDQVLGALLCLCGAG
LRAELDKQTRLVTLLGALAEKVRQAGGYARQVVLQEGLERVQSFFQRNSCRLPLSPSLEA
KQLNIKSCSFFNSNAVPLKLALVNADPLGEEINVMFKVGEDLRQDMLALQMIRIMDRIWL
QEGLDLRIVNFKCISTGKDKGMVELVPSSDTLRKIQVEYGVTGSFKDKPLAEWLRKYNPA
EDEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRSTGHMFHIDFGKFLGHAQMFGS
FKRDRAPFVLTSDMAYVINGGERPTSRFQLFVDLCSQAYNLIRKHSGLFLNLLSLMTLSG
LPELTGAQDLKYVYDALQPQTTDAEATIFFTRLIETSLGSVATKFNFFIHNLAQMRFSGL
PSNGEPILSFSPKTYTLKQEGRIRDASIFSFQKRYNPDKHYTYVVRLLREGQSEAQFLLR
TFDEFQELHNKLCILFPLWKLPGFPNRMVLGRTHIKDVAAKRKIELNSYVYNLLRSSTEV
TQCDLIYTFFHPIARDDKTEGFEAMSKAPDAPPLSPTLGRVEGEVKLSVSYRNSTLFIMV
MHIRDLVSEEGTDPNPYVKTYLLPDPHKTSKCKTKISRKTRNPTFNEMLVYSGYSKETLG
LRELQLSVLSAESLRENCYLGGVTLKLKDFDLSKETVNWYKLTAVPYF
NT seq 5187 nt NT seq  +upstreamnt  +downstreamnt
atggcccagatatccagtggtaatgggttcaagctggatgtggcccagccaaagggggtt
gtgggtaaggaggaggcccttcgtatggaggcggaggccttagcgaaactacaaatggag
aagagacagacgctcccggcgacctcctcttccacctcctcttctgcttcctcacaaaac
aaacttcatcctgccgccgctcccaggcctactccttcctccagcaaccgaccggagaag
gatctcatcgtcttccccgaggccaagacgcaggcagagaaggacaagttccgggacatc
gacgtcgacaaactgaccaaccaggagctagagaagctcctgctggacgacagctttggg
gccaacagcagcaaggcctcgcggccctccttgctgctggggttcaacctcagcgcttct
tacccggggggctacgccacctgcagcccctcgcccttccacaggggccagtggacgccc
tccatgctctccacgccctccagttcgggcgtgtccacacccacccaccagcaggctccc
atgttcccttctgctccgttccctaaccccgaaaacttctccttccacaatggcttttca
ccggccatgccgccctacataggcctgcccggcccgcagacctcattcatggccttcact
cccatccagcagcccggggccatggtgttccagcagcccaccgtcaccctggagatggcc
aagctcttcgacaagatccacagtacctcggaatacttgaagaatggcaggtcggccagc
actgacctggattcttcgtcgaccagcgtcgcgtccctggcgcccaacccaccacaacct
gccgtggaatcccctgctttcagccgcttcgagtggctggacctggacccactcaacaag
cgcaaagccgagggcgaggagggctcctccctggcatcgcgcggtacagtaatggtggtg
ggagggccagctggaggggacccctgggatgccgtgctgctcgacgagacagagggtgtg
gctggtggcagcagtccacccgtggaggtgacgggtcaactcgcgggtcgctctcagccc
cggaggtcgtcgacgggggcagcggtcaccaggaaccactcccttaccatcccagcgtcc
tcatcacagcaaaagccaaacaatcagcacgataagggaagtgggaaagcactggcaaag
tacactgccctggaggaaaaggaagcccagaacctagaagttgtagccttctgtgaagac
gtagcaatactgaggtcaaagtttgcccacgatgacctccacaccaacccggggtacgtg
ctgagcgcggtgatcccccagagggacgggggaggggacaacggctgcagcgtcaaggtg
tccatcgagatctctgagtcccaggagcctgtcaccttcacctgcgacgtgagttctcct
gtagagctcctcatcatgcaagccctgtgttgggtccacgacgacctcaaccaggtggac
atcggcagctacgtcctcaaggtctgcggccaagaggaggtgctgcaaaataagcacagc
ctgggcagccacgagtacgtacagaactgcaggaagtgggaggcagagatcaagctccag
ctgctctcccagagcaccatgagaagggatctggcacgaacggcggaagacgacacctct
caggtggacttggagaggcacttgggccaagtggagaggccgttcaaggagaacgtcacc
agacaagggctggctgactatctggaaggctatcacaatcaagtcaacatctgcctgcag
aatgagagcacccaatataagacggtggatcgggtggtgcagacagtgaagaacctttgc
tgtgccctggacgaggtggagacgcaggccatcacagaagcagtgagaagggttaagcat
tctgtcaacctccccaggacacgctcgccagaggtgggctccaaatcctcagcaaatggt
cacctcagccccgtggaggaatgcatgggcttcctgacggatgccgtctacgacctggcc
aagctttacttgcgctccttctgccccgccgcctcctctacctcttcccccgacccctcc
tccaactcccagcatgtcgagggggagtctgctgcggaggggcgtggcagcaaggaggcc
tcgggcaccacggaccatctgcagttcaccctgttcgccatgcacggcatccccgctgtc
tgggtcagcagctatgagaagtactatctgatgtgtgctttgactcacaacggcaggaac
ctgttcaagcccatccagtccaagaaagtggccacctacaagagcttcttctaccacatc
aaatgggacgaaatgatcaactttccaatggcggtggccctgcttccattggagtcaatg
ctgactctgtccctctttggggtcctgaaccagaacgccagcggctccccggactccaac
aaacagcacaagggaccagaagtgctgggcaaagtctccctgcccctatttgacttccga
cgggtgctggcgaggggaaccaagctgctgtgtctgtggacctcttctcaggctgcctct
gctgcagccgggatccggaggaagaacctggccgagaggatcatactgcaggtcgacttc
cccagcccagtggtggacgtgctgtacgttgggccccaggagagcccctgccctgacccc
aacaccctggaggagctggatcctgacctgcgccgccgggtggagaaactttgcagccga
gcctctaccttcgggttgacgcgggctgaccgccagctgctgtgggaccagcggcaccac
tgccgggctcacacccacagcctgcccaaggtgctggccagcgcccccagctgggactgg
ggcagcatagctgagattcacgccctactccacaactggccctcactccaacccgtctgt
gctctggagctgctcgactctaagtttgctgacacagaggtgaggagtgtggctgtcagc
tggatcgaatccagcagtgatgacgagttggccgactacctgcctcagctagtgcaggcg
ctgaagtttgagtgtcacctgaataacgccctggtgatattcctgctgtccagagcacag
ggcaacgtcaacatcaccctttacctgtactggctactgagggatgcggtgcaggaccca
gcgtttggccggaggtacgaccaggtgctgggggcactgctttgtctgtgtggggccggc
ctccgggccgagctggacaaacagacccgcttggtcactctgctgggggcgctggccgag
aaggtccggcaggccgggggctacgcacgacaggtggtgctccaggaaggtctggagagg
gtgcagtcattcttccagaggaacagctgcagactgcccctcagccccagcctggaggcc
aaacaactcaacatcaagtcgtgctccttcttcaactccaatgcggtgcccctgaagctg
gccctggtgaacgctgaccctctgggagaggagatcaatgtcatgttcaaggtgggagag
gacctgcggcaggacatgctggctctgcagatgatccggattatggaccgcatctggctt
caggagggactggacctgcgcatagtcaacttcaaatgcatctccactggcaaagacaaa
ggtatggtggagctggtgccgtcctcagacacactgaggaagatccaggtggagtacggc
gtgacgggctccttcaaggacaagcccctggcagagtggctccgcaagtacaaccctgct
gaggatgagtacgagaaggcgtcggagaacttcatctactcgtgtgcgggctgctgcgtg
gccacctacgtgctgggtatctgcgaccgccacaacgacaacatcatgctgcgctccacc
ggtcacatgttccacatcgacttcggcaagttcctgggccacgcccagatgttcggcagc
ttcaaaagggaccgtgctccattcgtgctgacctctgacatggcctacgtgatcaacggg
ggggagaggcccaccagtcgcttccagctgtttgtggacctgtgctcccaggcctacaac
ctcatccgtaaacactcaggcctcttcctcaacctgctctcactgatgacgttgtcaggc
ctaccagagcttactggagctcaggaccttaagtacgtgtatgacgcgctgcagccccag
accaccgacgctgaggccaccatcttcttcaccaggttgattgagaccagcctgggcagc
gtggccaccaagttcaacttcttcatccacaacctggcccagatgcgcttctcaggcctg
ccgtccaacggcgagcccatcctctccttctcccccaagacctacacgctgaagcaggag
ggacgcatccgcgacgcctccatcttctccttccagaagagatacaaccccgacaagcac
tacacgtatgtggtgagactcctgcgagaggggcagagcgaggcccagtttctcttacgc
accttcgacgagttccaggagctccacaacaaactgtgcatcctcttccctctgtggaag
ctgccagggttccctaataggatggtgctgggccgtacacacatcaaggacgtggcggcc
aagaggaagattgagctcaacagctatgtctacaacctgttgaggagctccacagaggtc
acccagtgtgatcttatctatacattcttccatccgatcgcgagagacgacaagacggaa
ggattcgaggcgatgtccaaagcaccagatgcgccaccattgagtcccaccttaggcaga
gtggagggggaggtgaagctgtctgtttcctacaggaacagcacactcttcatcatggtc
atgcacatccgagacctggtatctgaggaggggacagaccctaacccttatgtgaaaacc
tacctgctcccagacccccacaaaacctccaagtgcaaaacaaagatatccaggaagacc
aggaaccccactttcaacgaaatgctggtgtacagtggctacagcaaggagacccttggg
ctgcgggagctacaactgagcgtgcttagtgccgagtcgctgagagagaactgctacctg
ggcggcgtcacgctcaaactcaaggacttcgacctcagcaaggagacggtcaattggtac
aagctgaccgccgtgccctacttctag

DBGET integrated database retrieval system