KEGG   Salvelinus alpinus (Arctic char): 111962292Help
Entry
111962292         CDS       T05762                                 

Definition
(RefSeq) septin-7 isoform X1
  KO
K16944  septin 7
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:salp04131]
    111962292
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:salp04812]
    111962292
   04147 Exosome [BR:salp04147]
    111962292
Membrane trafficking [BR:salp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    111962292
Cytoskeleton proteins [BR:salp04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     111962292
Exosome [BR:salp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111962292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 Ras Fez1 AAA_22 Gtr1_RagA AAA_16 FeoB_N AAA_7 Roc AAA_29 ABC_tran
Motif
Other DBs
NCBI-GeneID: 111962292
NCBI-ProteinID: XP_023841037
AA seq 465 aa AA seqDB search
MEKCGTQEKENTQLGNALAVIWCEIHCLHDDVSQMMDMMDMIRLQRNLEGYVGFANLPNQ
VYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSLRIKKTVQVEQSKVL
VKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINFIDSKCEDFLNAESRVNRRLMPDNRVH
CCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHK
IRIYEFPDAEDDEDSKLIRKIKERMPLAVVGSNVVIEVNGKKVRGRQYPWGVAEEGIFVE
NGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGGVDTSKTKNQMTRS
PLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKKNLEVQY
KELEEKRRHHEEERCNWEAQQRILEQQKLDASKTMEKNKKKGKIF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatgcggtactcaagagaaggagaacacacaacttgggaacgcgttggctgtc
atctggtgtgagatccactgtctccatgacgacgtctctcagatgatggatatgatggat
atgatacgactccagaggaatctggaggggtatgtggggttcgccaacctccccaaccag
gtgtacaggaagtcagtgaagaggggctttgagttcacactaatggttgttggtgagtct
ggattggggaaatccacgctcatcaactccctcttcctgactgacctgtactccaaggat
taccctggcccatccctacggatcaagaagactgtgcaggtggagcagtccaaggttctg
gtgaaggaagggggtgtccagctcactctcaccatcgtcgatacgccagggtttggagat
gcagtggacaatagtaactgctggcagcctgtcattaacttcattgacagtaagtgtgag
gacttcctgaatgcagagtccagggtgaaccgacgactgatgccagacaacagagttcac
tgctgcctgtacttcatcgccccctctggccacgggctgaagcccctggacattgagttc
atgaagcgtctccatgacaaggtcaacgtgatccctctcatcgccaaggcagacactctg
acacctgaagaatgccagctgttcaagaaacagatcatgaaggaaatccaagaacacaag
atcaggatctatgagtttcctgacgccgaggacgatgaggacagcaagctcatccggaag
atcaaggagcggatgcctctggcagtggttggcagcaacgtggtgattgaagtgaacggc
aagaaggtcagaggtcgtcagtacccctggggcgtggcagaagagggcatttttgtggag
aacggggagcactgtgacttcactgtcttacggaacatgctgatcaggacccatatgcaa
gatctgaaggatgtgaccaacaacgttcactatgagaactaccgcagcaaaaagcttgct
gccgtaacctgcaatggaggagtggacaccagcaagaccaagaaccaaatgaccaggagc
cccctggcccagatggaggaggagcggagggaacatgtcatgaagatgaagaagatggaa
acagagatggagcaggtgtttgagatgaaggtcaaggagaagaaacagaaactgaaggac
tctgaggctgagctggagcgacgccacgagcagatgaaaaagaacttggaggttcagtat
aaggaactggaggagaagaggcgccaccatgaggaggaaaggtgcaactgggaggcacag
caacgtatactggagcagcagaaacttgatgcttctaagaccatggaaaagaacaaaaag
aaaggaaaaatattttaa

DBGET integrated database retrieval system