KEGG   Salvelinus alpinus (Arctic char): 111963800Help
Entry
111963800         CDS       T05762                                 

Definition
(RefSeq) interleukin-1 beta
  KO
K04519  interleukin 1 beta
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04060  Cytokine-cytokine receptor interaction
salp04217  Necroptosis
salp04620  Toll-like receptor signaling pathway
salp04621  NOD-like receptor signaling pathway
salp04623  Cytosolic DNA-sensing pathway
salp04625  C-type lectin receptor signaling pathway
salp04933  AGE-RAGE signaling pathway in diabetic complications
salp05132  Salmonella infection
salp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111963800
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111963800
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111963800
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111963800
   04621 NOD-like receptor signaling pathway
    111963800
   04623 Cytosolic DNA-sensing pathway
    111963800
   04625 C-type lectin receptor signaling pathway
    111963800
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111963800
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111963800
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111963800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:salp04052]
    111963800
   00536 Glycosaminoglycan binding proteins [BR:salp00536]
    111963800
Cytokines and growth factors [BR:salp04052]
 Cytokines
  Interleukins
   111963800
Glycosaminoglycan binding proteins [BR:salp00536]
 Heparan sulfate / Haparin
  Cytokines
   111963800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1
Motif
Other DBs
NCBI-GeneID: 111963800
NCBI-ProteinID: XP_023843097
AA seq 278 aa AA seqDB search
MDFDLADALTSSYSSMEFDTEYRPPDAKSGPETERCGLHAPLNLDLEVILQHRGGMRQVA
HLVIALHRMKNPFRKSDSTHTPLDVECTDEQFCSIIMDNLLEECVMVPIQEPRGAVTKKE
RGTFEQIGSPEQYSLCDHHQKSLVYCHRTMELKAVTIQGGKRRARFNLSKYSNASTTNQA
LPVVLGIDQWNLSCSKQADSATPVLQLERCEDQLTTIGAQEKTVRFLFYKNTTGFSMTTF
ESAMYPGWFISTSLEPSQPIEMCQKQDARKLMTFMVKN
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgatttagctgacgctctgacgagctcatattcgagtatggagtttgatacc
gaataccgcccgcctgatgcgaagagtggaccagagacggagcgctgtgggctgcacgcg
cccctgaacctcgacttggaggttatcctacagcatcggggaggcatgagacaggtggct
cacctggtgattgcgctgcatcgaatgaaaaaccccttccggaagtcrgactccacacac
actcctctggacgtggagtgcaccgacgagcagttttgcagcatcatcatggataacctg
ctggaagagtgtgtgatggtcccgatccaggagccaaggggagcggtgaccaaaaaagaa
agggggaccttcgagcagattggcagccccgagcagtatagcctgtgtgaccatcaccag
aagagcctggtgtactgccacagaaccatggagctgaaggccgtcacaatccagggaggc
aaacggagagcgaggttcaacctctccaagtatagtaatgccagcaccaccaatcaggcc
ctgccagttgtcttagggatagaccaatggaacctctcctgctccaagcaggcagacagc
gcaactcctgtcctacagttggagcgctgtgaggaccagttaacaaccatcggggctcag
gaaaaaacagttcgcttcctcttctacaagaataccactggcttctcaatgaccaccttc
gagtcggcaatgtaccccggctggttcatcagcacctcactggagccaagccagcccata
gaaatgtgtcagaaacaggacgccagaaagctcatgaccttcatggtcaaaaactaa

KEGG   Salvelinus alpinus (Arctic char): 111974578Help
Entry
111974578         CDS       T05762                                 

Definition
(RefSeq) interleukin-1 beta
  KO
K04519  interleukin 1 beta
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04060  Cytokine-cytokine receptor interaction
salp04217  Necroptosis
salp04620  Toll-like receptor signaling pathway
salp04621  NOD-like receptor signaling pathway
salp04623  Cytosolic DNA-sensing pathway
salp04625  C-type lectin receptor signaling pathway
salp04933  AGE-RAGE signaling pathway in diabetic complications
salp05132  Salmonella infection
salp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111974578
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111974578
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111974578
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111974578
   04621 NOD-like receptor signaling pathway
    111974578
   04623 Cytosolic DNA-sensing pathway
    111974578
   04625 C-type lectin receptor signaling pathway
    111974578
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111974578
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111974578
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111974578
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:salp04052]
    111974578
   00536 Glycosaminoglycan binding proteins [BR:salp00536]
    111974578
Cytokines and growth factors [BR:salp04052]
 Cytokines
  Interleukins
   111974578
Glycosaminoglycan binding proteins [BR:salp00536]
 Heparan sulfate / Haparin
  Cytokines
   111974578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1 IL1_propep
Motif
Other DBs
NCBI-GeneID: 111974578
NCBI-ProteinID: XP_023858183
AA seq 259 aa AA seqDB search
MEFESNYSLIKNTSESAAWSSKLPQGLDLEVSHHPITMRHIANLIIAMERLKGGEGVTMG
TEFKDKDLLNFLLDSAVEEHIVLELESAPPASRRGAGFSSKSQYECSVTDSENKCWVLMN
EAMELHAMMLQGGSSYHKVHLNLSTYVKPVPIETEARPVALGIKGSNLYLSCSKSGGRPT
LHLEEVADKEQLKSISQESDMVRFLFYRRNTGVDISTLESAGFRNWFISTDMQQDTKPVD
MCQKAAPNRLTTFTIQRHN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgagtcaaactacagtttaataaagaacacctctgaaagtgcagcatggagc
tccaagctgcctcagggtctggatctggaggtatcccatcaccccatcaccatgcgccac
attgccaacctcatcatcgccatggagaggttaaagggtggcgagggggttaccatggga
accgagttcaaagacaaggacctgctcaacttcttgctggatagtgctgtggaagaacat
atagtgttggagttggagtcggcgcccccagcgagcaggaggggagcagggttcagcagt
aaatcacagtatgagtgtagcgtcactgactctgagaacaagtgctgggtcctgatgaat
gaggctatggagctgcacgccatgatgctccagggaggcagcagctaccacaaagtgcat
ttgaacctgtcaacatacgtcaagcccgtccccattgagactgaagccagacctgtagcc
ctaggcataaagggatccaatctctacctgtcctgctccaaatcgggaggcaggcccacc
ctgcacctagaggaggttgcggacaaggagcagctgaagtccatcagccaggagagcgac
atggtgcgtttccttttctacagacggaacaccggggttgacatcagtaccttggagtct
gccgggttcaggaactggttcatcagcacggacatgcagcaggacaccaaaccggtggac
atgtgtcagaaggcagcccccaaccgcctcaccaccttcaccatccagcgccacaactaa

KEGG   Salvelinus alpinus (Arctic char): 112071295Help
Entry
112071295         CDS       T05762                                 

Definition
(RefSeq) interleukin-1 beta-like
  KO
K04519  interleukin 1 beta
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04060  Cytokine-cytokine receptor interaction
salp04217  Necroptosis
salp04620  Toll-like receptor signaling pathway
salp04621  NOD-like receptor signaling pathway
salp04623  Cytosolic DNA-sensing pathway
salp04625  C-type lectin receptor signaling pathway
salp04933  AGE-RAGE signaling pathway in diabetic complications
salp05132  Salmonella infection
salp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112071295
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112071295
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    112071295
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112071295
   04621 NOD-like receptor signaling pathway
    112071295
   04623 Cytosolic DNA-sensing pathway
    112071295
   04625 C-type lectin receptor signaling pathway
    112071295
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112071295
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112071295
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112071295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:salp04052]
    112071295
   00536 Glycosaminoglycan binding proteins [BR:salp00536]
    112071295
Cytokines and growth factors [BR:salp04052]
 Cytokines
  Interleukins
   112071295
Glycosaminoglycan binding proteins [BR:salp00536]
 Heparan sulfate / Haparin
  Cytokines
   112071295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1
Motif
Other DBs
NCBI-GeneID: 112071295
NCBI-ProteinID: XP_023994527
Position
Unknown
AA seq 264 aa AA seqDB search
MEFESNCSLMKNTSASVAWSSKLPQGLDVEISHHPITLRCVANLLIAMERLNGGKGFTLG
TEFRDEDLLNFLLESAVDEHIVLESGSAHTEHIEARSRAPGFSSKGEYECSVTDSENKCW
VLNEGSMELHAMMLQGGSSYHKVHLNLSTYVTPVPSETEARPVALGIKGSNLYLSCITSG
GTPTLHLEEVADKEQLKSINHESDMVRFLFYKRDTGVDVSTLESAHSRNWFISTALQQDN
TKMVNMCQRATPNRFTTFTIQRHN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgagtcaaactgcagtctaatgaagaacacctctgccagtgtagcatggagc
tccaagcttcctcagggtctggatgtggaaatatcccatcaccccatcaccctgcgctgt
gtggccaacctcctcatcgccatggagagactaaatggtggcaaggggtttaccctggga
accgagttcagggatgaggacctgctaaatttcttgctagagagcgcagtggacgaacat
atagtgttggagtcggggtcggcgcacacagagcacattgaagccagaagcagagctcca
gggttcagcagtaaaggagagtacgagtgtagtgtcactgactctgagaataagtgctgg
gtgctgaacgaagggtctatggagctgcatgctatgatgctgcagggaggcagcagctac
cataaagtgcatttgaacctgtctacgtacgtaacgcctgtccccagtgagactgaagca
aggcctgtagccctgggcatcaagggatccaacctctacctatcctgcataacatcagga
ggcacgcccaccctgcacctagaggaggtggcagacaaggaacagctgaagtccatcaac
catgagagcgacatggtgcgcttcctcttctacaaacgggacaccggagttgacgtcagt
accctggagtctgcccattccaggaactggttcatcagcacggccctacagcaggacaac
accaaaatggtgaacatgtgccagagggcaacccccaaccgcttcaccacattcactatc
cagcgccacaactaa

DBGET integrated database retrieval system