KEGG   Salvelinus alpinus (Arctic char): 111964472
Entry
111964472         CDS       T05762                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00230  Purine metabolism
salp00240  Pyrimidine metabolism
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111964472
   00240 Pyrimidine metabolism
    111964472
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     111964472
SSDB
Motif
Pfam: dNK AAA_18 AAA_17 Cloacin_immun
Other DBs
NCBI-GeneID: 111964472
NCBI-ProteinID: XP_023844134
AA seq 174 aa
MFSRKPAHPSHLSYVVVLSVSRYIFAANLNESLNETEWSIYQDWHGWLHKQFGKRIELDG
IIYLQAAPERCMERLHLRGREEEQGIPLEYLEKLHFKHESWLQHKTMRXEREEGSVDGIV
NEEGSVTEGSRLSMVYEYLIDTPILTLDINKDFKGDKVKGADVVEKVKEFLSTL
NT seq 525 nt   +upstreamnt  +downstreamnt
atgttctctagaaagccagcacacccctctcatttgtcctatgttgttgttctgtctgtg
tccagatacatctttgcagcgaacctgaatgagagtctgaacgagacagagtggtctatc
taccaggactggcacggctggctccacaaacagtttgggaaacgcatcgagctggacggc
atcatctaccttcaagccgcaccagagagatgcatggagaggctacatctgagaggcaga
gaggaggagcagggcattcctctggagtacctggagaaactccacttcaaacacgagagc
tggctgcagcacaaaaccatgcggygagagagggaggaaggaagtgttgatgggattgtg
aacgaggaagggagtgttacggaagggagtaggttgagcatggtatatgagtatctgatt
gacacgcccattctgacgctggatatcaacaaagattttaaaggggacaaggtcaagggt
gctgacgtggtggaaaaggtcaaagaatttctcagtaccttgtaa

DBGET integrated database retrieval system