KEGG   Salvelinus alpinus (Arctic char): 111965042Help
Entry
111965042         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: succinate-semialdehyde dehydrogenase, mitochondrial-like
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00250  Alanine, aspartate and glutamate metabolism
salp00650  Butanoate metabolism
salp01100  Metabolic pathways
Module
salp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    111965042
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111965042
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     111965042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 111965042
NCBI-ProteinID: XP_023844774
AA seq 509 aa AA seqDB search
MGSFCLLRSRCLPRQVGLPLVMHRQYSLDISAQLLRTQGYVNGQWINAPSTFPVLDPATG
EEIAKVADCGPAEAKLAVDAAYKAFYSWKQHTAKSVLLRKWYDLLTLNKEDLAKLITFEC
GKPMKEXLGEIAYAAGFLEWFSEEARRVYGDVVPSAAKDRKILLLKQPVGVASIITPWNF
PSAMITRKVGAALAAGCTVVVKPAEDTPLSALALAELASQAGIPAGVFNVVPCSREKTPS
VGMVLCTDPLVGKVSFTGSTATGKILLKHAADTIKRVSMELGGHAPFIVFDSADVDKAVA
GAMNSKFRNSGQTCVCSNRFLVQSKIHDRFIEKLGKAMDAELRLGHGSDPNTTQGPLINV
RASEKVEHQVMDAVSRGAKVLRGGKRLDGSFHQPTLLVDVTTDMLCTREETFGPLLPVIR
FSTEEEALAIANASHVGLAGYFFSQDVSQIWRVAENLEVGMVGVNEGLLSTPEASFGGVK
QSGLGREGSKYGIEEYLDVKYMCFGGLTP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggtagtttctgtctcctaagaagtcggtgtctcccccgccaggtcggcctaccattg
gtcatgcatcggcaatacagccttgacatttccgctcagcttctccgaacgcagggctat
gtgaacgggcaatggatcaatgctccctctaccttcccagtgctggacccagcgacgggg
gaagagattgcgaaagtcgccgactgcggtccagcagaagctaaactagctgtcgacgca
gcctacaaggcattctactcctggaaacaacacacagcgaaaagtgtccttctacggaaa
tggtacgatctgttgacgttgaacaaggaggaccttgctaagctgatcacctttgagtgt
ggtaagcccatgaaggagntcctgggggagattgcttacgctgctggcttcctggaatgg
ttctctgaggaggcgcgccgtgtctacggggatgttgtgccctcggctgccaaggaccgt
aagatccttctgctcaaacagcctgtgggcgtggcctcaatcatcactccgtggaacttc
cccagtgctatgatcaccaggaaagtgggtgctgccctggccgcgggctgcaccgtcgtg
gtgaaacctgccgaggacacaccmctctctgccctggcgctcgctgagctggcaagtcag
gccgggatccctgcgggggtgtttaacgtggttccctgctccagagagaagaccccctct
gttgggatggtcctctgcacagaccccctggtggggaaggtctccttcactggatccact
gccactggaaagattctcttgaagcacgctgccgacaccatcaagagggtttcaatggag
ctgggtggccatgcccccttcattgtgtttgacagtgcggatgtggacaaggctgtggcg
ggagccatgaactccaagttcaggaactcaggacagacatgtgtctgctccaaccgtttc
ctggtccagagtaagatccacgatcgcttcatagagaagttggggaaggccatggacgca
gagctccgtctgggccacggctctgacccaaacaccacccagggacccctcatcaatgtc
cgtgcctctgagaaggtggagcaccaggtgatggatgcagtgtcgcggggggccaaggtg
ctaaggggggggaagcgtctggacggctcgttccatcagcccactctgctggttgatgtc
actacagacatgctgtgtaccagagaggaaacctttggtcctctcctgcctgtcatcagg
tttagcacagaggaggaagcacttgccattgccaatgcatctcatgtgggtttagcaggg
tacttcttctcccaggacgtcagtcagatctggcgtgtggcggagaatctggaggtaggc
atggtgggggtgaacgagggtctcctctccaccccagaggcctccttcggcggggtcaaa
caatcaggcctgggccgtgagggctccaagtatggcattgaggagtacctggacgtcaag
tacatgtgctttggagggctaaccccctga

DBGET integrated database retrieval system