KEGG   Salvelinus alpinus (Arctic char): 111966074Help
Entry
111966074         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: neuronal acetylcholine receptor subunit alpha-2-like
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111966074
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:salp04040]
    111966074
Ion channels [BR:salp04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   111966074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Motif
Other DBs
NCBI-GeneID: 111966074
NCBI-ProteinID: XP_023846272
AA seq 644 aa AA seqDB search
MLSMLPMXAEERLLKNLFAHYNKLSRPVANTSDVVLVHFGLSIAQLIDVDEKNQMMTTNV
WVKQEWNDYKLRWNPEEYENVTSIRIPSEIIWRPDIVLYNNADGDFAVTHLTKAHLFYDG
RIKWMPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDRAKIDLISIASDVDQMDYWESG
EWVIINAVGKYNTKKYECCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYL
PSQCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFV
LNVHHRSPRTHGMSHWVRRVFLDLVPRVLFMKRPPATAKQNCRKLIEMMHRTSSSTAASQ
SQSFWAGVETGLGQLGQLGQLGHTLPATPSDSSNILALSPSPSPSPTQGLPLEEHPLKAP
QLFCRSPSSQYSILLEEPGKLGNTASPLSCSTHSSTPSSSPPSLPLGPLGPVHSLPRDEP
QILSPNGRSHSVEHVFDHQREPNWEPPQRVGHRCRSHSFQYCCLHEEGGGVAGGGKGREA
VGEGRLKRQVLLDQLARASSTEPTVDLVIRETMVPRISPSMRRAIEGVQYIADHLRAEDA
DFSVKEDWKYVAMVIDRIFLWMFVLVCILGTLGLFLPPWLAGMI
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgctttccatgctgcccatgnccgctgaggagaggcttctcaagaacctgtttgcccac
tacaacaagctgtcccggcctgtggccaacacctccgacgtggtgctggtccactttggc
ctctccatcgcccagctcatcgacgtggacgagaagaaccagatgatgacgaccaacgtc
tgggtgaaacaagagtggaatgattataaactccgctggaacccagaggagtacgagaat
gtcacctccatccgcatcccctcagaaatcatctggaggcctgatattgtgctttataac
aacgctgatggtgacttcgcggtgacccacctgaccaaggcccacctgttctacgacgga
cgcatcaaatggatgccaccggccatctacaagtcctcctgcagcattgacgtcaccttc
ttccccttcgaccagcagaactgcaagatgaagtttggctcgtggacttacgaccgtgcc
aagatcgacttgatcagcatagccagtgatgtggaccagatggactactgggagagcggc
gagtgggtgatcatcaacgctgtgggcaagtacaacaccaagaagtacgagtgctgcacc
gagatctaccccgacatcacctattacttcatcatccgcaggctgccgctcttctacacc
atcaacctgattataccatgtctgttgatctcctgtctgactgtcttggtcttctatctg
ccctcccagtgtggcgagaagatcaccctgtgtatctctgtgttgctgtctctcaccgtc
ttcctcttgctcattaccgagatcatcccatccacctcgctggtcatcccgctcatcggc
gagtacctcctcttcacaatgatcttcgtcaccctctcgattatcatcaccgtctttgtg
ctcaacgtgcaccaccgctcgccgcgcacacacggcatgtcgcactgggtgcgccgggtc
ttcctggacctggtgcctcgtgtgcttttcatgaagcggccaccggccacagccaagcag
aactgccggaagctgattgagatgatgcaccggaccagctcctcgacagcagccagtcag
tcgcagtctttctgggccggggtggaaacggggctaggacagctaggacagctaggacag
ctgggacacacactgcctgccaccccctctgacagctccaacatcctagccctttcccct
tcaccatctccctctcctacccagggcctgcccttggaggagcaccccctcaaggccccc
cagctcttctgccgctccccttccagccagtactccatcctcctggaggagcctggcaaa
ctcgggaacactgcctcccctttgtcctgctcaacccactcctccactccgtcatcctcc
cccccgtctctgccgctgggtcccctgggtccagttcactctcttccccgggacgagcca
caaatactgtcccccaacgggcggagccacagtgtagagcacgtgtttgaccaccagagg
gagcctaactgggagcccccccaaagggtcgggcaccgctgccgctcccacagcttccag
tactgctgcctgcacgaggaagggggtggggttgctggtggtggcaagggccgagaggct
gtaggtgaaggaaggctaaagagacaggttctgctagaccaactagctagagcctcctcc
acagagcccactgttgatctagtgatccgggaaaccatggtccccagaatatccccgtcg
atgagaagggccatagagggtgtgcagtacatcgctgaccacctcagggcagaggacgcc
gacttctcagtaaaggaggactggaagtatgtggccatggtcattgacaggatatttctc
tggatgtttgtactagtgtgtatactgggaacactgggactattccttcctccttggctg
gctggaatgatctag

DBGET integrated database retrieval system