KEGG   Salvelinus alpinus (Arctic char): 111967580Help
Entry
111967580         CDS       T05762                                 

Definition
(RefSeq) tryptophan 2,3-dioxygenase A
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00380  Tryptophan metabolism
salp01100  Metabolic pathways
Module
salp_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    111967580
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     111967580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-GeneID: 111967580
NCBI-ProteinID: XP_023848473
AA seq 414 aa AA seqDB search
MSGGCPYFEKRHLLFKSKLHLEEEEEDDSQEGINKASKGGIIYGDYLQLDKVVTAQVLQS
ELKGNKIHDEHLFIVTHQAYELWFKQILWELDSVREIFISGHVRDERNMLKVNTRIHRIV
MIFRLLVDQFAVLETMTALDFYDFREYLSPASGFQSLQFRLLENKIGVLDNLRVPYNRRH
YRDNFKGHESEMLLRSEKEPCLLKLVEKWLERTPGLEEDGFNFWVKLEANIFEGLSLEKS
KIEKMQDSEEKEEMMEEMTKQKELFTSLFDVKRHEHLLGKGERRISYKALQGALMIYFYR
EEPRFQVPFQLLSNLMDIDTLMTKWRYNHVCMVHRMIGSKAGTGGSSGYHYLRSTVSDRY
KVFVDLFNLAMFLIPRHWVPKLDPNEHTFLFTAEYCDSSYCSSEDSDSDTVSTV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtggatgtccatacttcgagaaaaggcacttgctattcaagagcaagctgcat
ctagaagaggaagaggaagatgactctcaagaaggaatcaacaaggccagcaaaggtggc
atcatctatggtgactaccttcagcttgacaaagtcgtgacggcccaagttcttcagagt
gaactgaaggggaacaaaatccacgatgagcatcttttcattgtcacacatcaagcttat
gaactctggttcaagcagattctatgggaactggattcagtgcgagagattttcatcagt
ggacatgttcgcgatgaacgtaacatgctgaaggtcaacacccgcatacacaggattgtt
atgatcttcaggctgctggtcgaccagttcgccgtactcgagacgatgaccgccttggac
ttctatgacttcagagagtacctgtcccctgcctccgggttccaaagtctccagttccgt
ctgttggagaacaagatcggggtccttgacaacctgagagtcccctacaacaggcgccac
tacagggacaacttcaaaggacatgagagtgagatgctgcttagatctgagaaggagcct
tgtctgctgaaattggtggagaaatggctggaaagaaccccaggtcttgaagaggatggg
tttaacttttgggttaaactggaagccaacatctttgaaggattgagtcttgaaaaaagt
aaaatagagaaaatgcaagactctgaggagaaggaggagatgatggaagagatgacaaaa
caaaaagagctatttacttctctgtttgatgtcaaaagacatgagcatcttttgggcaaa
ggtgagagacggatctcctacaaagctctccaaggagctctgatgatctacttctacagg
gaggagcccaggttccaggttcccttccaactcctgtccaacctgatggacattgatacc
ctcatgacaaaatggagatacaaccatgtgtgcatggtgcacagaatgattggcagcaaa
gcaggcactggaggctcatctggctaccactacctccgctctactgtcagtgatcgctac
aaagtctttgtggatctcttcaacctggccatgtttttgatacctcggcattgggtgcct
aaactagaccccaacgagcacacctttctgttcaccgcagagtactgtgacagctcctac
tgcagtagtgaggattcagactcggacactgtctcaactgtctga

DBGET integrated database retrieval system