KEGG   Salvelinus alpinus (Arctic char): 111967610
Entry
111967610         CDS       T05762                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04080  Neuroactive ligand-receptor interaction
salp04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111967610 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111967610 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 111967610
NCBI-ProteinID: XP_023848539
AA seq 78 aa
MNVKILTLVIVLLVSLLCSASAGPIMASTEHGTALEEAGAVRRLVQQNPGRGGQSHRPAG
WKRRRPRPRLSHKGPMPF
NT seq 237 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
agtgctggtcccattatggcctccacggagcatggcacagcactagaagaggcgggcgcc
gtgagaaggctggtccagcagaaccccggcaggggtggccagagccacagaccagccggc
tggaagaggagacgcccacgaccccgtctctcccacaaggggcccatgccattctag

DBGET integrated database retrieval system