KEGG   Salvelinus alpinus (Arctic char): 111967680Help
Entry
111967680         CDS       T05762                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:salp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111967680
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:salp03041]
    111967680
Enzymes [BR:salp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111967680
Spliceosome [BR:salp03041]
 Complex C
  Other components
   Step II factors
    111967680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 T2SSE Flavi_DEAD ABC_tran AAA_19 PRP38_assoc DUF2075 AAA_30 AAA_7 AAA_16 PhoH Sigma54_activ_2 Herpes_DNAp_acc
Motif
Other DBs
NCBI-GeneID: 111967680
NCBI-ProteinID: XP_023848684
AA seq 1186 aa AA seqDB search
MADFGVEELKRLEYLSLVSKVCTELDNHLGICEKDLAEFVICLAEKKPTFDGFKSLLLKN
GADFTDSLISNLLRLIQTMRPSKESGSKASEPVVKQKSEKDKLKEMFPGLCRPDNPAPIP
LEEDDVRVADAAMKELEMFMPSVSGTNSTSRLDNKRQRSRSRSQDRDRKRRSRSPSCDRE
RDRDFKRGRKRVSRWSDRSPSPTRDRDFEVGSDRYKDKHVDRPPPEEPAVGDIFNGKVTS
ILQFGCFVQLEGLRKRWEGLVHISELRKEGRVANVADVVQKGQRVKVKVLSFTGSKTSLS
MKDVDQETGEDLNPNRRRNLGPDGGEEKIMRNPDRPTDLNLGHAPELEDDTLERKRLTKI
SDLEKWEINQMIAANVLSKEEFPDFDEETGILPKIDDEEDQDLEIELVEEEPPFLRGHTK
QSMDMSPVKIVKNPDGSLSQAAMMQSALAKERREVKQAQRMAEMDCIPIGLNKHWVDPLP
DFDGRQIAANMRGIGMMPDGVPEWKKHAFGGNQASYGKKTAMSILEQRESLPIYKLKEQL
IQAVHDNQILIVVGETGSGKTTQITQYLAESGYSTRGKIGCTQPRRVAAMSVAKRVSEEY
GCCLGQEVGYTIRFEDCTSPETVIKYMTHGMLQRECLIDPDMGQYTIIMLDEAHERTIHT
DVLFGLLKKTVKKRPDMKLIVSSATLDAVKFSQYFFEAPIFTIPGRTFPVEVLYCKEPET
DYLDASLITVMQIHLTEPPGDVLVFLTGQEEIDTACEILYERMKSLGPEVPELIILPVYS
ALPSEMQTRIFDPAPPGSRKVIIATNIAETSLTIDGIYYVVDPGFVKQNVYNSKTGVDQL
VVTPISQAQAKQRSGRAGRTGPGKCYRLFTERAYRDEMLTSNVPEIQRTNLASTMLSLKA
MGINDLLSFDFMDAPPMETMITAMEMLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLI
MSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQQMADQKKAKFHQAEGDHLTLLAVYNSWKN
NKFSNPWCFENFIQARSLRRAQDIRKQMLGIMDRHKLDMVSCGKATVRIQKAICSGFFRN
AAKKDPQEGYRTLIDQQVVYIHPSSSLFNRQPEWLVYHELVLTTKEYMREVTTIDPRWLV
EFSPAFFKVADPTRLSKQKKMQRLEPLYNRYEEPNAWRISRAFRRK
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atggcagactttggagttgaggagcttaagcggcttgaatacctgtctttggtgtccaaa
gtgtgtacagaacttgacaaccatcttggtatttgcgagaaagatcttgctgagtttgtc
atctgccttgctgaaaagaaaccgacatttgatggcttcaaatcacttctgctgaaaaat
ggagcagacttcacagattctctcatcagcaatttgctcagacttattcaaactatgcgg
ccgtcaaaagaatctgggagcaaagcctctgagcctgtggtcaaacagaagagtgagaag
gacaaactgaaggagatgtttcctggattgtgcaggccagacaatccagctcccattccg
ctagaagaagatgatgtgagggtagcagatgctgccatgaaagaattggagatgttcatg
cccagtgtcagtggaacaaactcaacgagcaggttggacaacaaaaggcagcgaagcaga
agtcggagccaagacagagacaggaagagacgctcacgctctccgtcttgtgaccgtgag
agggacagagacttcaaacgcggtcgaaaacgtgtttcccgctggagtgatcgcagtccg
agccccaccagggatcgagattttgaggttggttctgaccgctataaggacaaacacgtg
gaccggcccccaccagaagagcctgctgtaggggacatattcaacggcaaagtcaccagc
atcctgcagtttggctgcttcgtgcaactggaggggctgaggaaacgctgggaggggttg
gtgcacatctctgagttacgcaaagagggacgtgttgccaacgtggctgatgtggtccag
aaaggtcaacgagtcaaggtcaaggtgctgtccttcactggctccaagaccagtctcagc
atgaaggatgtagaccaggaaacaggggaggacctgaaccccaacaggaggaggaacctg
ggccctgatggtggggaggagaaaatcatgaggaaccccgaccgcccaaccgacctcaac
ctgggccacgcccctgagttggaggatgacacactggagcgcaagagactgaccaagata
tctgacctcgagaagtgggagatcaaccagatgattgctgctaatgttctttctaaagag
gagttccctgactttgacgaggagacgggtatcctcccaaaaattgatgatgaagaagat
caggacctggagattgagctagtggaggaggagcctccgttcctgagaggacacactaaa
cagagtatggacatgagccctgtcaagattgttaagaatccagacggctcgctgtcccag
gcagccatgatgcagagtgctttggctaaggagaggagggaggtgaagcaggctcagcga
atggctgagatggactgcatacctattggcctcaacaagcactgggtagaccctttgcct
gactttgatggaaggcagattgcagccaacatgagaggaatcggcatgatgccagacggc
gtcccggagtggaagaaacatgcctttgggggcaaccaggcctcttatggcaagaagaca
gcaatgtccatcctagagcagagagagagcctgcccatctacaagctgaaagagcagctc
atacaggctgtccacgataatcagatcctgattgtggttggagagactggctctgggaaa
actacccagatcacccagtacctggccgagtcgggctactccactcgggggaagatcggc
tgcactcagccccgtcgtgtggcagccatgtccgtggccaagagagtctctgaagagtac
ggttgctgtctgggccaggaggtgggctacaccatccgttttgaggactgcaccagtcct
gagacggtgatcaagtacatgacacatggtatgctgcagagggaatgtctgatagatccg
gacatgggtcagtacaccatcatcatgcttgacgaggcccacgagaggaccatccatact
gatgtgctctttggtctactcaagaagacagtgaagaaacgcccagacatgaagctgatt
gtgtcctcagcgacactagatgctgtcaagttctcccagtacttcttcgaggcgcccatc
tttaccatcccaggacgtactttcccagtggaggtgctctactgcaaagagcctgagacg
gactacctggacgccagtctcatcaccgtcatgcagatccacctgaccgagcctccaggt
gatgtcctggtgtttctgacaggtcaggaggaaattgacacagcatgtgagatcttgtat
gaacggatgaagtctctgggacctgaagtgcctgaactcatcattttacctgtctactcc
gcgctgccaagcgagatgcagacccggatctttgaccctgctccccccggcagcaggaag
gtaatcattgccactaacattgctgagacgtctctgactattgatgggatctactatgtg
gtggacccaggctttgtgaagcagaatgtctacaattccaagactggtgtcgaccaatta
gtggtgacccccatatcacaggcccaagccaagcagcgttctggtagggctggaagaact
ggccctgggaaatgctaccggctatttacagagagagcctacagagacgagatgctcacc
agcaatgtgcctgaaatccagagaacaaacctggccagtaccatgctgtctctcaaggcc
atgggcatcaatgacctgctatcatttgatttcatggacgctccacccatggagacaatg
atcacagctatggagatgctctacactttaggggctctggatgatgaggggttactcact
cgccttggacgcaggatggctgagttccctctggagcccatgttgtgtaagatgctgatc
atgtccgtccacctgggctgcagtgaggagatgctcaccatcgtctccatgctgtctgtg
cagaacgtcttctacaggcccaaggacaagcagcagatggctgaccagaagaaggccaag
ttccaccaggccgaaggagaccacctcactctgctggctgtctataactcctggaagaac
aacaagttctccaacccctggtgcttcgagaacttcatccaggcccgttccttgcgcaga
gcccaggatatccgcaaacagatgctgggtatcatggacaggcataaactggacatggtg
tcttgtggaaaggccacagtgcgcatacagaaggccatctgcagtggtttcttccggaac
gcagccaaaaaggatccccaggagggctaccgtacccttattgaccagcaggtggtgtac
atccacccctccagttccctgttcaaccgccagcctgagtggttagtgtaccatgagttg
gtgctgactactaaggagtacatgagggaggtgaccaccattgacccacgctggctggta
gagttctcgccggcctttttcaaagtggccgatcccacgcgtctcagcaaacagaagaag
atgcagcgcctcgagcccctctacaaccgctacgaagagcccaacgcttggagaatctcc
cgcgcctttcgcaggaagtag

DBGET integrated database retrieval system