KEGG   Salvelinus alpinus (Arctic char): 111967720Help
Entry
111967720         CDS       T05762                                 

Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04012  ErbB signaling pathway
salp04068  FoxO signaling pathway
salp04137  Mitophagy - animal
salp04140  Autophagy - animal
salp04141  Protein processing in endoplasmic reticulum
salp04210  Apoptosis
salp04217  Necroptosis
salp04310  Wnt signaling pathway
salp04510  Focal adhesion
salp04530  Tight junction
salp04620  Toll-like receptor signaling pathway
salp04621  NOD-like receptor signaling pathway
salp04622  RIG-I-like receptor signaling pathway
salp04625  C-type lectin receptor signaling pathway
salp04910  Insulin signaling pathway
salp04912  GnRH signaling pathway
salp04914  Progesterone-mediated oocyte maturation
salp04920  Adipocytokine signaling pathway
salp04933  AGE-RAGE signaling pathway in diabetic complications
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111967720
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111967720
   04012 ErbB signaling pathway
    111967720
   04310 Wnt signaling pathway
    111967720
   04068 FoxO signaling pathway
    111967720
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111967720
   04137 Mitophagy - animal
    111967720
  09143 Cell growth and death
   04210 Apoptosis
    111967720
   04217 Necroptosis
    111967720
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111967720
   04530 Tight junction
    111967720
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111967720
   04621 NOD-like receptor signaling pathway
    111967720
   04622 RIG-I-like receptor signaling pathway
    111967720
   04625 C-type lectin receptor signaling pathway
    111967720
  09152 Endocrine system
   04910 Insulin signaling pathway
    111967720
   04920 Adipocytokine signaling pathway
    111967720
   04912 GnRH signaling pathway
    111967720
   04914 Progesterone-mediated oocyte maturation
    111967720
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111967720
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111967720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    111967720
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111967720
Protein kinases [BR:salp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111967720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 111967720
NCBI-ProteinID: XP_023848777
AA seq 428 aa AA seqDB search
MNRNKREKEFYSLDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYIVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSIGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFLMKLNQSVRTYVENRPRYAGFTFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVSEALQHPYINVWYDPTEVEAPPPLITDKQLDEREHTVEEWKDLIYMEV
QDWEERTKNGVIRGQPASLGAAVSSGSQQYPSVSSSSVNDVSTDPTLXSDTDSSLETASN
TDPLGCCR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggaataagcgtgaaaaggagttttacagtttagacgtcggggattccactttt
acggtgttgaagcgctaccagaatttaagacccataggctccggagcacaagggattgtc
tgctcagcatatgaccacaaccttgaacgcaacgttgcaattaaaaagctcagccgacct
ttccagaaccagacccatgccaaaagagcttacagagaactggtgctcatgaaatgtgtc
aaccataagaacattattggcttgttaaatgtattcacgccacagaagacactggaggag
ttccaagatgtttatattgtgatggagctgatggatgccaacctgtgccaggtgatccag
atggagctggaccacgagcggctgtcctatctgctctaccagatgctgtgtggcatcaag
caccttcacgccgcgggcatcatacacagggatctgaaacccagcaacattgtggtaaag
tcggactgcacactgaagatcctggacttcggattggccaggacagcggccacaggcctc
ctgatgaccccgtatgtggtgacccgctactaccgcgcccctgaagtcatcttgggcatg
ggttaccaggccaacgttgatgtctggtctattggctgcatcatggcagaaatggtccga
ggtagtgtgttgttcccaggcacagatcatattgatcagtggaacaaggtgatcgagcag
ttggggactcccagtcaggagttcctgatgaagctcaaccagtcggtaaggacctacgtg
gagaacagaccccgctacgccgggttcacctttgagaagctcttccccgacgtcctcttc
ccagccgactcggagcacaacaaactgaaagcaagtcaagccagagacctattatcaaag
atgctggtaatagatgcatccaaacggatctctgtgagcgaggctctccagcacccctac
atcaacgtgtggtatgatccaactgaagtggaggcgcccccaccgttgatcactgacaag
cagctggatgagagggaacacacagtggaggagtggaaagatttgatatacatggaggtc
caggactgggaggagagaacgaagaatggagtgatccggggacagccagcgtctttaggt
gcagcagtgagcagcggctcccagcagtacccttctgtatcgtcctcgtccgtcaacgat
gtgtccaccgaccccaccctgycttccgacacggacagcagcctggagacagcctctaac
acggacccactgggctgctgcagatga

DBGET integrated database retrieval system