KEGG   Salvelinus alpinus (Arctic char): 111967728Help
Entry
111967728         CDS       T05762                                 

Definition
(RefSeq) palmitoyltransferase ZDHHC16B isoform X1
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111967728
Enzymes [BR:salp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     111967728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC PHO4
Motif
Other DBs
NCBI-GeneID: 111967728
NCBI-ProteinID: XP_023848787
AA seq 360 aa AA seqDB search
MRSWRWQFSRMMRLCLRWCRLCPKRGGRPSKPQRKLRELWSYWKLLLNSLYFNSLTNSDT
CLDCVFEPVYWIVDNVTRWFGVVFVCLVIALTSSVLVIVYLCLLPVILNTYPLQWIVWHL
TYGHWVLIMVLFHYYKATTTSPGHPPQVKSDTPSVSICKKCIVPKPARTHHCSICNTCIL
KMDHHCPWLNNCVGHFNHRYFFSFCLYMTMGCMYCSVSCKDMFIEAYNAVESYYQTPPPL
FSFREKMVHKSIIFIWVLTSSVAVALGGLTLWHAILITLGETSVERHINKKEVRRLKEKG
KVFRNPYHYGKINNWKVLFGVEETSHWLTRVLLPSSHTPHEDGLVWEFPQAFTRRDPMTI
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagctggaggtggcagttctccaggatgatgcgtctgtgcctgcgctggtgccgg
ctgtgccctaagcgygggggtcgacccagcaagccccagaggaagctacgagagctgtgg
agctattggaagctgctgctcaactccctctacttcaacagcctcaccaactctgacacc
tgcctggactgtgtctttgagcccgtctactggatagtsgacaatgtgactcgctggttt
ggggtggtgtttgtgtgcctggtgattgccctcaccagctctgtgctggtcattgtctac
ttgtgcctgctgcctgtcatcctcaacacctacccgctgcagtggatcgtctggcacctc
acttacggccactgggtcctcataatggtcctcttccactactacaaggccaccaccacc
tcccctggacacccaccacaggttaaaagtgatacaccgtcagtgtccatctgtaaaaaa
tgcatcgtccccaaaccagccagaactcaccactgcagcatctgcaatacgtgtattctg
aagatggatcaccactgtccctggctcaacaactgtgtgggccacttcaaccaccgctac
tttttctccttctgcctgtacatgaccatgggctgcatgtactgcagcgtcagctgcaaa
gacatgttcatagaggcctacaacgctgtcgagagctactatcagacgccaccaccacta
ttttccttcagagaaaagatggtccacaagagtataattttcatttgggtgctaacaagt
tcggtggcagtagctctgggaggtctgacactgtggcatgctatcctcatcaccctaggg
gagaccagcgtggagagacacatcaacaagaaagaggtcagacgkttaaaggagaaggga
aaggtgttccgaaatccataccattatgggaaaataaacaattggaaagtgttgtttggt
gtggaggagacaagtcactggttgaccagagtcctcctgccgtctagtcacactccccat
gaagatggactggtatgggaattccctcaggctttcaccagaagagacccaatgaccatc
taa

DBGET integrated database retrieval system