KEGG   Salvelinus alpinus (Arctic char): 111968757Help
Entry
111968757         CDS       T05762                                 

Gene name
gpx2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00480  Glutathione metabolism
salp00590  Arachidonic acid metabolism
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111968757 (gpx2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111968757 (gpx2)
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     111968757 (gpx2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 111968757
NCBI-ProteinID: XP_023850375
AA seq 191 aa AA seqDB search
MTFIAKTFYDLKAMTLEGDSVDFNVFRGRVVLIENVASLUGTTTRDYSQLNLLQSKYPHR
LVVLGFPCNQFGYQENCSNGEILNSLKYVRPGDGYQPGFTVFEKCDVNGTNTHPVFAYLK
DKLPYPDDDPHTLIQDPKFLIWSPISRTDISWNFEKFLVGPEGEPFKRYSKKFETINIEP
DIQRLLRLTKT
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcatcgcgaagaccttctatgatctgaaggccatgaccctggagggggattca
gtagacttcaatgtgtttcgagggcgggtggtcctcattgagaatgtggcatcgctctga
gggacaaccacccgggactacagccagctcaacttgctccagagcaagtaccctcaccgg
ctagtggtcctgggcttcccctgcaatcagtttggctaccaggagaactgttcaaatggg
gagatcctgaactcattgaagtatgtgcgtccaggagatggctaccagcctggcttcact
gtctttgaaaagtgtgacgtgaatggaaccaacactcaccctgtctttgcctatttgaaa
gacaaacttccctatcctgatgatgatccacacaccctcatccaggatcctaaattcctc
atctggagtcccatcagcaggacagacatctcttggaattttgagaaattcctggttggg
ccagagggagagccctttaaacgttatagcaaaaaatttgagactatcaacatcgagcct
gacatacaaagactgttgagactaaccaagacctga

DBGET integrated database retrieval system