KEGG   Salvelinus alpinus (Arctic char): 111969532Help
Entry
111969532         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00232  Caffeine metabolism
salp00983  Drug metabolism - other enzymes
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    111969532
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    111969532
Enzymes [BR:salp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     111969532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 111969532
NCBI-ProteinID: XP_023851481
AA seq 290 aa AA seqDB search
MNLEEYFKKIGFHGPFSKPDLETLNQVHKHHVMSIPFENLSIHCGEKITMDHELIFNKIV
RSNXGGWCCENNLLFAWVLKEIGYNPVTLGSRVYNNTINQFGPKDSHLINKVVIDGTAYI
ADVSFGVSSQIWHPLELVSRKDQPQSPGVFRLIQDGDLWTLEKTGQKPLVLNEAFTNSPL
VDKSPTTKIYGFTQVPRGVDNFLETSHCLQTDPKSLFTNKSICSMQTATGFRALIGWTFS
EVTYNNQDGFDVLDMKDISDDDVDKVLKEMFNVLLANKLVPINNKAGYTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaatctggaagagtacttcaagaagatcgggttccacggcccattttctaaaccagac
cttgaaacactgaaccaggtccacaaacaccatgtgatgtcaataccatttgaaaacctc
agcattcactgtggtgagaagatcactatggaccatgagttgattttcaataagattgtg
aggagcaatncggggggttggtgttgtgagaataacctcctctttgcttgggtgctaaaa
gagataggttataatccagtaacactgggttcaagagtctacaacaacaccataaaccag
ttcggcccaaaagactctcacctcatcaacaaggtagttattgatgggactgcttacatt
gcagacgtgagctttggggtatcctcccaaatatggcaccctcttgagctcgtctccagg
aaggaccagccacaatcccctggcgtcttccgtctcatacaagatggagacctgtggacc
ctggagaagactggtcaaaagcctctggttctcaatgaggcctttaccaactcgcctctg
gtagacaagagcccaaccacgaagatctacggcttcacccaggttccccgtggggttgat
aatttcctagagacttcccactgccttcagacagatccaaagtctctattcaccaacaag
tccatctgctcgatgcagacggctacaggattcagagctctaattggctggaccttcagt
gaggtcacctacaacaaccaggatggttttgatgttttggatatgaaagacatatctgat
gatgatgtggataaagtgctgaaggaaatgtttaatgtgttgttagcaaacaagctggtt
cccataaacaacaaagctggctacactatttaa

DBGET integrated database retrieval system