KEGG   Salvelinus alpinus (Arctic char): 111969936Help
Entry
111969936         CDS       T05762                                 

Definition
(RefSeq) succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00020  Citrate cycle (TCA cycle)
salp00640  Propanoate metabolism
salp01100  Metabolic pathways
salp01200  Carbon metabolism
Module
salp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
salp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111969936
   00640 Propanoate metabolism
    111969936
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:salp04147]
    111969936
Enzymes [BR:salp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     111969936
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     111969936
Exosome [BR:salp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111969936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 111969936
NCBI-ProteinID: XP_023852103
AA seq 432 aa AA seqDB search
MAASIVSQIVARGLRGASAKHLFLDKFKCARVSSRRWLNLQEYQSKKLMQESGVTVQRFY
VADNAPDALQAAKRLGAKEIVLKAQILAGGRGKGVFDSGLKGGVHLTKDPSVVGELANKM
LGYSLTTKQTPKEGVKVKTVMVAEALDITRETYFAILMDRACNGPVMVGSPQGGMDIEEV
ADKTPELIFKEVVDIFEGVRDDQALRMAAHLGFKGPLERQAADQIKRLYDLFLKVDATQV
EVNPLGETPEGQVVCFDAKINFDDNAEFRQKAVFALDDMSESDPTETEAAKWDLKYIGLD
GNIACFVNGAGLAMATCDIIDLHGGKPANFLDLGGGVKEKQVYEAFKLLTADPKVEAILV
NIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAKRILSESGLPIIAANDLDD
AAKKAVAAIAKK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcggcatccatcgtatcccagattgtagcgagaggactacgtggagcaagcgccaag
cacttgtttcttgacaaattcaagtgtgcacgggtgagttccaggcgatggctgaacctg
caggagtatcagagcaagaagctgatgcaggagagtggggttacagtccagcgcttctac
gtggctgacaatgcccctgacgccctgcaggctgccaagagactcggtgccaaggagata
gtcctgaaggcccagattctggctgggggacgaggcaagggcgtgttcgacagtggcctt
aaaggtggagtgcacttaactaaagacccctcggtggtgggtgagctggccaataagatg
ctaggttatagcctgaccaccaagcagactccaaaggagggagtgaaagtaaaaacggtg
atggtggctgaagccctggacatcaccagggaaacctactttgccatcctgatggaccgg
gcctgcaacgggcctgtcatggtgggcagtcctcagggtgggatggacatagaggaggtg
gccgacaaaaccccagagctcatatttaaggaagtcgtagatattttcgagggggtgcga
gacgaccaggcgctccgcatggcagctcatttgggtttcaaaggacctctggagagacag
gctgcagatcagattaagaggctctatgatctgttcctgaaagtcgacgccactcaagtt
gaagtcaatcctctcggagagactcccgaaggacaagtggtgtgctttgatgccaagatc
aattttgacgataacgcagagttccgtcagaaagccgtctttgccctggacgacatgtca
gagagcgatcccaccgagacggaggcagccaaatgggacctcaagtacatcggcttggat
ggaaacatcgcctgctttgtgaatggggctggtctggctatggccacatgtgatatcatc
gacctccatggagggaagccggccaacttcctggacctgggaggaggggtgaaggagaag
caggtgtacgaggccttcaaactgctcactgctgaccccaaggtggaagccatcctggtg
aacatcttcgggggcatcgtcaactgtgccatcattgccaacggtatcaccaaggcttgc
cgtgagctggagctcaaagtgcctctggttgtcaggctggaagggaccaatgtgcaggag
gccaagaggatcctgtcagagagtggactgcccatcatagccgccaatgacctggatgac
gctgccaagaaagctgtggccgccattgccaagaagtag

DBGET integrated database retrieval system