KEGG   Salvelinus alpinus (Arctic char): 111970500
Entry
111970500         CDS       T05762                                 

Definition
(RefSeq) retinol dehydrogenase 7 isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    111970500
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     111970500
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR Phage_rep_O
Other DBs
NCBI-GeneID: 111970500
NCBI-ProteinID: XP_023853048
AA seq 345 aa
MDIDSVYQYLGFQAQTNDSGPSSRDNLWLYGISTFVVLWALGWLYRDSLEVEDVKEKYVF
VTGCDSGFGNLLCKRLDRRGFRVIAGCLTEKGADDLKRATGPYLKTVLLDVTSTGSIQKA
MEYTKQEVGDNGLWGIVNNAGRSLPMGPTEWMRMEDFTSTLKVNMTGVIEMTLTFLPLIK
QAQGRIVNVASVLGRVAANGGGYCISKFAVESFSDCLRRDIHYFGIKVCIIEPGFFKTAV
TSLDPIERELHRLWNQLTPEVKASYGDKYLDNYIQIQRLIMNAVCDSDLSKVTNCMEHAL
ASSYPRTRYSAGWDAKFGWIPLSYMPSCVIDIGLKLVMPRPAKSV
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggatattgattctgtgtaccagtatttaggatttcaagcacaaaccaacgattcaggg
ccttcaagcagggataatctatggctgtacggcatttctaccttcgtcgttctgtgggcg
ctaggctggctgtacagagacagtctggaagtagaggacgtcaaggagaagtatgtgttt
gtgacggggtgtgactctggctttgggaacttgctctgtaagaggctggaccgacggggg
ttcagggtgatagctgggtgtctgacggagaaaggggctgatgatctgaagagggcgact
gggccgtacctgaagacggttctcctagacgtgacgagcaccggcagtatacagaaagcc
atggagtacaccaagcaggaggttggagataacggactgtggggtatcgtgaacaacgcg
gggcgctccctgcccatgggtcccacagagtggatgaggatggaggacttcaccagtacc
ctgaaggtgaacatgacgggggtgatagagatgaccctcaccttcctgcccctyatcaaa
caggcccaggggaggatcgtgaacgtggcctcagtgctgggtagagtggcagctaacggc
gggggatactgcatctctaagttcgctgtggagtccttctcagactgcctcaggagggat
atccactactttgggatcaaggtgtgcatcattgaaccaggtttctttaagacagcggtt
accagtctggatcccatcgagagagagctgcatcgcctgtggaaccagctcacacctgaa
gtaaaggccagctacggagacaaatacctggataattacatccagatccaacggttgatc
atgaacgcggtgtgtgactcggacctgagtaaagtgactaactgcatggaacatgccttg
gcgtcgtcctacccccgaacccgctacagtgccggctgggacgccaagttcggatggatc
cccctctcttatatgccatcctgtgtcatcgatattgggctgaagctggtgatgccgcgt
cctgctaagagtgtgtag

DBGET integrated database retrieval system