KEGG   Salvelinus alpinus (Arctic char): 111970567Help
Entry
111970567         CDS       T05762                                 

Definition
(RefSeq) actin-3-like
  KO
K05692  actin beta/gamma 1
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04145  Phagosome
salp04210  Apoptosis
salp04510  Focal adhesion
salp04520  Adherens junction
salp04530  Tight junction
salp04810  Regulation of actin cytoskeleton
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111970567
  09143 Cell growth and death
   04210 Apoptosis
    111970567
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111970567
   04520 Adherens junction
    111970567
   04530 Tight junction
    111970567
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111970567
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111970567
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:salp03021]
    111970567
   03019 Messenger RNA biogenesis [BR:salp03019]
    111970567
   03036 Chromosome and associated proteins [BR:salp03036]
    111970567
   03029 Mitochondrial biogenesis [BR:salp03029]
    111970567
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:salp04812]
    111970567
   04147 Exosome [BR:salp04147]
    111970567
Transcription machinery [BR:salp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     111970567
Messenger RNA biogenesis [BR:salp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     111970567
Chromosome and associated proteins [BR:salp03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     111970567
    NuA4 complex
     111970567
  Chromatin remodeling factors
   BAF complex
    111970567
   PBAF complex
    111970567
   SWR1 complex
    111970567
Mitochondrial biogenesis [BR:salp03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    111970567
Cytoskeleton proteins [BR:salp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     111970567
Exosome [BR:salp04147]
 Exosomal proteins
  Proteins found in most exosomes
   111970567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin MreB_Mbl
Motif
Other DBs
NCBI-GeneID: 111970567
NCBI-ProteinID: XP_023853152
AA seq 369 aa AA seqDB search
MTAVDSSEDFKQNVAIVIDPGSGSIKAGFSGDEKPHKVLRSVVGLSKKDQTECYFGNNIP
CKDSDDLILKRPITSGMISDWDSLEKLWSHVLYEELQVCPEEHGILMTDPAFSPISNREK
TAELLFEGFGAPAMYVGYQPVLSMYSYGLVTGLVVDSGAGCTSVSPVCNGYCLPHATFHM
DLAGKGVSDYLSKLLADVGHGSALQQMSSVQEMKKQSCYVSQLSSEDKGTPLDYQLPDGT
TITLGDERFRGPEILFCPSDAGMSQPGVHILATNSLQKCAPEWQAALMANVALCGGSSMF
SGFPERLQAEMEKLAPRDSIIGMLSGAHREFASWVGGSIITCLSSFQPMWVKVQEYQEEG
SSVVRNKCY
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagtggatagcagtgaggacttcaagcagaatgtggctattgtaatcgaccca
ggatcaggctccatcaaagctggcttctctggagatgagaagccccataaagttctgagg
tcagtggttggattgtccaaaaaggaccaaactgaatgttattttggaaacaacattccc
tgcaaggactcagatgatctcattctcaagaggcccatcaccagtggaatgataagtgac
tgggattccctggagaagctgtggagccatgtgctctatgaggagctgcaagtctgccca
gaagagcatggcatcctgatgactgacccagccttctctcccatctccaaccgagagaag
acagctgaactcctgtttgaagggtttggggccccagcgatgtatgttggttaccagcct
gtgctgtccatgtattcttatggactggttactggtctagtggtggactctggggctggc
tgcacctctgtctctcctgtgtgcaatggctactgcttaccacatgccacatttcacatg
gacctggctggaaagggtgtgtctgactatctgagcaaactactggccgacgttggacat
gggagtgctctccagcaaatgtcctctgtgcaagagatgaagaagcagagttgctacgtc
tcccagctgagttctgaggacaaaggcacacctctggactatcaactccccgatggcacc
accattaccctgggcgacgagcgcttccgtggccctgagatcctattctgtccatccgac
gcaggaatgtcgcagcccggagttcacatcctggccacgaacagcctgcagaagtgcgcc
cccgagtggcaggcggccttgatggccaacgtggccctgtgtggcggctcctcgatgttc
agcggtttcccggagcggctccaggcagagatggagaaactggccccgagggactccata
atcgggatgctatctggggctcacagggagtttgcctcctgggtggggggctccatcatc
acctgcctcagcagcttccagcccatgtgggtgaaggtgcaggagtaccaggaggagggc
tccagtgtggtgcgcaataaatgctattag

KEGG   Salvelinus alpinus (Arctic char): 112074402Help
Entry
112074402         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: actin, non-muscle 6.2-like
  KO
K05692  actin beta/gamma 1
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04145  Phagosome
salp04210  Apoptosis
salp04510  Focal adhesion
salp04520  Adherens junction
salp04530  Tight junction
salp04810  Regulation of actin cytoskeleton
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112074402
  09143 Cell growth and death
   04210 Apoptosis
    112074402
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112074402
   04520 Adherens junction
    112074402
   04530 Tight junction
    112074402
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112074402
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112074402
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:salp03021]
    112074402
   03019 Messenger RNA biogenesis [BR:salp03019]
    112074402
   03036 Chromosome and associated proteins [BR:salp03036]
    112074402
   03029 Mitochondrial biogenesis [BR:salp03029]
    112074402
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:salp04812]
    112074402
   04147 Exosome [BR:salp04147]
    112074402
Transcription machinery [BR:salp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     112074402
Messenger RNA biogenesis [BR:salp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     112074402
Chromosome and associated proteins [BR:salp03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     112074402
    NuA4 complex
     112074402
  Chromatin remodeling factors
   BAF complex
    112074402
   PBAF complex
    112074402
   SWR1 complex
    112074402
Mitochondrial biogenesis [BR:salp03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    112074402
Cytoskeleton proteins [BR:salp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     112074402
Exosome [BR:salp04147]
 Exosomal proteins
  Proteins found in most exosomes
   112074402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 112074402
NCBI-ProteinID: XP_023997352
Position
Unknown
AA seq 376 aa AA seqDB search
MAEDDXAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
TQIMFETFNSPAMYVGIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLD
LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMRTSAASSSLEKS
YELPDGQVITIGNERFRCPETMFQPSFIGMESTGVHETTYNSIMKCDVDIRKDLYANTVL
SGGTTMFPGIADRMQKEISSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
QEYEESGPSIVHRKCF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagacgatnttgctgcactggtggttgacaatggttcaggcatgtgcaaggct
ggttttgcaggagacgatgctccccgtgctgtcttcccctccattgttggaagacccaga
catcagggtgtgatggtgggcatgggacagaaggacagctacgtgggcgacgaggcccag
agcaagaggggcatcctgactctgaagtaccccatcgagcacggcattgttaccaactgg
gacgacatggagaagatctggcatcacaccttctacaatgagctgcgtgtggcccccgaa
gagcatcccgtcctgctcacagaggccccactcaaccccaaagccaacagggagaagatg
acccagatcatgtttgagaccttcaacagcccagccatgtatgtaggtatccaggccgtg
ctttctttgtacgcatctggtcgcaccacaggaatcgtgatggattccggggatggcgtt
agccacacggtgcccatctacgagggctacgctcttccccacgccatcctgcgtttggac
ctggcgggacgcgacctcacggactacctgatgaagatcctgactgagcgtggctacagc
ttcaccaccacggccgagagggagattgtgcgtgacatcaaggagaagctggcctacgtg
gctctggactttgagcaggagatgaggacctctgctgccagttcctctctggagaagagc
tacgagctgcctgatggacaggtcatcactatcggcaacgagcgcttccggtgccctgag
accatgttccagccgtccttcattggaatggaaagcactggagtgcacgagaccacctac
aactctatcatgaagtgtgatgtggacatcaggaaagacctgtatgccaacactgttctc
tctggtggaaccaccatgttccctggcatcgccgatagaatgcagaaggagatcagtagc
ttggcaccccctactatgaagattaagatcatcgcccctcccgagcgtaaatactctgtg
tggattggcggctccatcctggcctctctctccaccttccaacagatgtggatttccaag
caggaatatgaggaatctggcccgtctatcgtccaccgcaaatgtttctaa

KEGG   Salvelinus alpinus (Arctic char): 112079525Help
Entry
112079525         CDS       T05762                                 

Definition
(RefSeq) actin, alpha skeletal muscle
  KO
K05692  actin beta/gamma 1
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04145  Phagosome
salp04210  Apoptosis
salp04510  Focal adhesion
salp04520  Adherens junction
salp04530  Tight junction
salp04810  Regulation of actin cytoskeleton
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112079525
  09143 Cell growth and death
   04210 Apoptosis
    112079525
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112079525
   04520 Adherens junction
    112079525
   04530 Tight junction
    112079525
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112079525
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112079525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:salp03021]
    112079525
   03019 Messenger RNA biogenesis [BR:salp03019]
    112079525
   03036 Chromosome and associated proteins [BR:salp03036]
    112079525
   03029 Mitochondrial biogenesis [BR:salp03029]
    112079525
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:salp04812]
    112079525
   04147 Exosome [BR:salp04147]
    112079525
Transcription machinery [BR:salp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     112079525
Messenger RNA biogenesis [BR:salp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     112079525
Chromosome and associated proteins [BR:salp03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     112079525
    NuA4 complex
     112079525
  Chromatin remodeling factors
   BAF complex
    112079525
   PBAF complex
    112079525
   SWR1 complex
    112079525
Mitochondrial biogenesis [BR:salp03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    112079525
Cytoskeleton proteins [BR:salp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     112079525
Exosome [BR:salp04147]
 Exosomal proteins
  Proteins found in most exosomes
   112079525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 112079525
NCBI-ProteinID: XP_024001226
Position
Unknown
AA seq 107 aa AA seqDB search
MESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIK
IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggagtcttgcggtatccacgagaccacctacaactccatcatgaagtgtgacgtggac
atccgtaaggacctgtacgccaacacygtgctgtccggaggaaccaccatgtaccccggc
atcgctgacaggatgcagaaggagatcacctctctggccccctcaaccatgaagatcaag
atcatcgcccctccagagcgtaaatactccgtctggatcggaggctccatcctggcttct
ctctccaccttccagcagatgtggatcagcaagcaggaatacgacgagtctggtccctcc
atcgtccaccgtaaatgcttctaa

DBGET integrated database retrieval system