KEGG   Salvelinus alpinus (Arctic char): 111970988Help
Entry
111970988         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00450  Selenocompound metabolism
salp00970  Aminoacyl-tRNA biosynthesis
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    111970988
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111970988
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:salp01007]
    111970988
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:salp03016]
    111970988
Enzymes [BR:salp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     111970988
Amino acid related enzymes [BR:salp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   111970988
Transfer RNA biogenesis [BR:salp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    111970988
 Prokaryotic type
   Other AARSs
    111970988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 111970988
NCBI-ProteinID: XP_023853547
AA seq 959 aa AA seqDB search
MKLFVSDGNPHCVKVLAVLGFTGVKCDVKHVNHEERVVPYLTXPALPALLLPSGTYLFXP
NSICQYLIEVNGQESSDIVNQWLEWEATELQPAVMQALHMVVLQGKEXRTTRVLQGPLSY
LDQGLSKRTTLFLTAEKVSVADVVCXGALYPILSDSSLVSGSNQTLQHWFERVGMLAACG
SAAQTALYGKGLKAESLKTYLQRQPATHQGQGQGRGTQPCNSPEGDDDGDCVLSEEEIQS
AAVTWGKGLADLPMVPERQHPILPKEGKRNVLVTSALPYVNNVPHLGNIIGCVLSADVFA
RYGRLRGWNVLYVCGTDEYGTATENKAREEGLTAQQICDKYHAVHASIYQWFQVDFDFFG
RTTTKKQTEIAQNIFWRLHERGFLLEDIVEQLRCEACQRFLADRFVEGTCPFCSYPEARG
DQCDKCGKLINAVELREPTCKVCSQTPVVQSSKHLFLDLPKLEPELEQWLERSTGSGDWT
ANAKQITRSWVRDGLKPRCITRDLKWGTPVPHPDFSDKVFYVWFDAPIGYLSITANYTDQ
WEKWWKNPQQVELYNFMAKDNVPFHSVVFPCSLLGAQDNYTLVNHLVATEYLNYEDTKFS
KSRGVGVFGDMAKDTGIPSDVWRFYLLYLRPEGQDSAFSWVDMATKNNSELLNNLGNFIN
RAGMFVSKFFENCVPAMALQQEDKRLLAQVGWELKQYINLMDRVKIRDALKCILNISRHG
NQYIQVNEPWKKIKGDETDRQRSGTVTGVSVNVACLLSVMLQPYMPTVSQTIRQQLNAPP
TVTGTMLQGTGNFVCSLPAGHHIGTVSPLFQKLESDQIESLKKRFGGQQPKTTAQTDVNA
QPAPTPASDPAAQTAVNGADAERARDLTLAVAEQGEKVRTLKGQKAEKAVIGAEVTKLLE
LKKQLSLAEGKHPEPVLTKGKKSAQPAPTPASDPAAQTAVNGADAERARDLTLAVAEQG
NT seq 2879 nt NT seq  +upstreamnt  +downstreamnt
atgaaactattcgtgagtgacggaaatccgcactgtgttaaggtgctagcagtgctcgga
tttactggagtcaaatgtgacgttaaacatgtcaaccacgaagagagagtggtaccctac
ctcaccngtccagccctgcctgccctgctcctccccagtggaacatacctcttcnaccca
aactcaatctgccaatacctgatagaggtgaatggacaggaatccagtgatatcgtcaac
cagtggctggaatgggaagctacagaactacagcctgcagtgatgcaggcccttcacatg
gtggtgctgcagggaaaggagnncagaaccaccagggttctacagggacctctcagctac
ctggaccagggcctgagcaagaggaccacgctgttcctcactgctgagaaggtttcagtg
gcagacgtggtctgtnngggagctctctaccccatcctgtctgacagcagtctggtatca
ggtagtaatcagacgctgcagcactggtttgaacgtgtgggcatgttggcagcctgtggg
tctgcagcccagactgcactgtacgggaagggactgaaggctgagtctctgaagacctac
ctgcagagacagccagccacacaccagggacagggacagggtagaggcacacagccatgc
aacagccctgagggtgatgatgatggtgattgtgtgctgtcagaggaagagattcagtct
gccgcggtcacctggggtaaaggacttgcagacttacccatggttccagagagacaacac
cctattcttcctaaggagggcaagaggaacgtcctcgtgaccagtgccttgccttatgtt
aacaacgtccctcatctgggcaacatcatcggctgtgtgctcagcgctgacgtcttcgcc
aggtacgggcgtctgcgtggttggaatgtactgtatgtgtgtgggactgatgagtacggt
acagctacagagaacaaggcccgtgaggaaggtctaacagcgcagcagatctgtgacaag
taccatgctgtccacgcctccatctaccagtggttccaggtcgactttgacttctttggc
cgcaccaccacaaagaaacagacggagatagcccagaacatcttctggcgtctccatgag
cgaggcttcctacttgaagacattgtggagcagctgcgctgcgaggcgtgccagcgtttt
ctagccgaccgcttcgtggagggaacatgtcccttctgctcttacccagaggcccgaggg
gaccagtgtgacaagtgtggcaagcttatcaacgctgtggagctacgggagcctacttgt
aaggtgtgcagtcagactcctgtagtccagtcctccaaacatctgttcctggacctgccc
aagttggagcctgagttggagcagtggttggagaggtctactgggtcaggggactggacg
gccaacgccaaacagatcaccagatcctgggtgagggacggactcaaaccccgctgcatc
accagagacctgaagtggggaacccctgtacctcaccccgacttctctgacaaggtgttc
tacgtgtggtttgacgctcctattggttacctgtccatcacagccaactacactgaccaa
tgggagaagtggtggaagaacccacagcaggtggagctctataacttcatggccaaggac
aacgttccgttccacagtgtggtgttcccctgctctctactgggagcacaggacaactat
acactggtcaaccacctggtggctacagagtacctgaactacgaggacaccaagttctct
aagagtcgaggtgttggtgtgtttggtgacatggccaaggatacgggcatcccctctgac
gtgtggcgattctacctgctctacctccgtcccgagggacaggactcggccttctcctgg
gtcgacatggccaccaagaataactctgagttgctcaataacctgggcaacttcatcaac
agggctggtatgtttgtcagtaagttctttgagaactgtgtacctgccatggctcttcag
caggaggacaagagactgttggctcaggtgggatgggagctgaagcagtacattaacctc
atggacagagtcaagatccgtgatgccctgaagtgtatcctcaacatctctcgccacggt
aaccagtacatccaggtcaacgaaccctggaagaaaatcaaaggagacgaaacagacagg
cagcgatcggggacagtgacaggtgtgtctgtgaatgtggcgtgtctgctgtccgtcatg
ctccagccctacatgccaacggtcagtcagaccatccgccagcagctgaacgccccgccc
accgttaccggcaccatgctgcagggcacagggaacttcgtctgctctctgcccgccggg
catcacattggcacggtcagcccgttgttccagaaactagagtccgaccagatcgagtct
ctgaagaagaggtttggaggacagcagccaaagacgacagcccagactgatgtcaacgct
cagcccgccccaaccccagcttcagatcctgctgctcagactgcagtgaacggtgcagac
gcagagagagccagggacttaacactggctgtggcagaacagggggagaaggtccggacc
ctgaagggccagaaggcagagaaagctgtgattggagcagaggtcaccaaactcctggaa
ctgaagaaacagctatccctggctgagggaaagcacccagaaccagtgctgacaaaaggc
aagaagagcgcccagcccgccccgaccccagcttcagatcctgctgctcagactgcagtg
aacggtgcagacgcagagagagccagggacttaacactggctgtggcagaacaggggga

DBGET integrated database retrieval system