KEGG   Salvelinus alpinus (Arctic char): 111971371Help
Entry
111971371         CDS       T05762                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:salp04131]
    111971371
Membrane trafficking [BR:salp04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    111971371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 111971371
NCBI-ProteinID: XP_023853880
AA seq 2160 aa AA seqDB search
MAERRAFAQKINRTVAAEVRKQIAGQYGGSPQLLKNLNVGAAASNTVPLTEAVEPVDFEE
YLSTHPPIIESGPLRDLIEFPPDDIEVVCTPRECRTVGQAVPEEGHNDAHVRDCVRSYTE
DWAVVNRRYHKLGTGFNPNTLDKQKERQKGLPKQVFEADEMPDVSAYQGDQDDLKRRSMS
IDDTPRGSWACSIFDLKNSVPDALLPHLLDRAPNEEIDRHNEEHRKSNRHRELFALHPAL
DEEEPIERHCVPDVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENFLF
DLNSXQTKGMLRSHIQTAAISTLARSAIFSITYPSQDVFLVIQLEKVLQQGDIGECAEPY
VVFKESDTAKNKEKLEKLRSQSDQFCTRLGRYRMPFAWTAIHLMNIVNSAGSLERDTELE
MGLPERKGSWSERRNSSVSGRRSLERTTSGDESCSLSSFRPATLTVTNFFKQEGDRLSDE
DLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPDLQQVKPYPDSRVRPTR
EILEFPPKDVYVPNTTYRNLLYVNPHSLNFANRQGSARNITVKVQFMNGEDPNNAMPVIF
GKSSCADYAKEAYTAVVYHNRSPDFHDEVKIKLPASLTDHHHILFTFYHVSCQQKQNTPL
ETPVGYTWIPMLQNGRLRTGNFCLPVSLEKPPQSYSVLSPDVPLPGMKWVDNHRGVFNVE
VTSVSTVHTQDQYLDKFFALVHALDHMFPVRIGDMRIMENNLEEELKSSIAALNSSQLEP
IVRFLHLLLDKLVLLVVRPPVISGQIVNLGQASFEVMASIVNRLHKYLDTSQDMHGRNSL
LSSYVYYVFRLPNMDPNSPSPGPGLGGSVHYATMARSAQRPASLNLNRSRSLSNSNPDIS
GTPTSPDDEVRSIIGSKGLDRSNSWVHTVRCKSTPWRSSHGSASDTDTDTMQAAERCGNR
MSSHTESASFLQTLTGRLPTQKLFHEELALQWVVSSGIVREGALQQAWFFFELMVKSIIH
HLYFTDRLESPRKNRFPERFMDDITALVSTIAGDIVSRFQKDLELVERLNTSLAFFLNDL
LSVMDRGFVFSLIKTYWKQVSTKLYVLQNPTLESLRLDFLRIICSHEHYVTLNLPCSLLT
PPASPSPSVSSATSQSSGFSAQDQKIANMFELSVPFREQHYLAGLVLTELAVILDPEGEA
MFGLHKKVISVVHNLLSSHDSDPRYADPEVKARVAMLYLPLIGIVMETLPQLHDFTESHI
QWGRPGGAQGSADGAGGDESVEDGNSMISQTVAMAIAGTSSPMSRPSSFLLNPQASRPHA
TFSAESSRSLLICLLWVLKNADECVLQKWFTDLSVSQLNRLLDMLYLCVSCFEYKGKKAF
ERMNSLTFKKSKDMKAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKD
MTHWRQHSERMDKSHRSLRFRDSILLHSPGSPTQTQEPLVVRTRAELEHEALIDGNLATE
ANLIILDTLEIIVQAVSVTESKESILGGMLKVLLHSMACNQSALYLQHCFATQRALVSKF
PELLFEKETEQCADLCLRLLRNCSSSIGTIRSHASASLYLLMRQNFEIGNNFARVKMQAT
MSLSSLVGTSQHFNGEFLRRSLKTILTYGEEDLELRETTFPDQVQDLVFNLHMILSDTVK
MKEHQEDPEMLIDLMYRIAKGYQTSPDLRLTWMQNMAGKHSERTNHAEAAQCLVHSAALV
AEYLSMLEDRKYLPVGCVTFQNVSSNVLEESAVSDDVVSPDEEGICSGKYFTEAGLVGLL
DQAASSFSLAGMYEAVNEVYKVLIPIHEANRDAKKLATIHGKLQEAFGKIVHQDGKRMFG
TYFRVGFYGSKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERYGEDQVEVIKDSNPVD
KCKLDPNKAYVQITYVEPYFDTYEMKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHDQ
FKRKTILTTSHAFPYIKTRINIIHKEEISSMPIEVAIEDMQKKTQELAFATHQDPSDAKM
LQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNK
SLIGPDQKEYQRELERNYHRLKEALQPLICRKIPQLYKPVLQVNSHRDSFSRMSLRKLEL
NT seq 6483 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcgccgcgcattcgcccaaaaaatcaacaggactgtagcagctgaggtgaga
aagcagattgctggtcagtatgggggctccccacagctcctcaagaacctcaacgtgggt
gccgctgcaagcaacaccgtgcctctcacagaggcagtggagccagtggattttgaggag
tacctcagcactcacccacctatcattgagtcgggccccctgagggacctgatcgagttc
cccccggacgacatcgaggtggtctgcacccccagagagtgtcgcacagtgggacaggcc
gtgcctgaggaagggcacaatgacgcccacgtcagagactgtgtcaggtcctacactgag
gactgggccgttgtcaacagaagataccataagcttggtactgggtttaaccctaacacc
ctggacaagcagaaggagaggcagaaaggcctgcccaaacaggtgtttgaggctgatgag
atgccagacgttagcgcttatcagggcgaccaggatgacctgaagcgtaggtccatgtcc
atagacgacactccgcgtggcagctgggcctgcagtatcttcgacctgaagaactctgtc
cccgacgccctcctgccccatttgctggaccgagcccccaacgaggagatcgaccggcac
aatgaggagcaccgcaagtccaaccgccatcgcgagctcttcgccctgcaccccgccctc
gacgaggaggaaccaatagagcgccactgtgtgcctgatgttcctaaggagcactttggc
cagaggttactcgtcaagtgcttgtccttgaagtttgagatcgaaatcgagcccatattc
gccagtttggccttatacgatgtcaaggaaaagaaaaagatatcagagaacttcttattc
gacctgaactcgkagcagactaaagggatgctgcgctcccacatccagacagcagccatc
tccaccctggcccgctcagccatcttctccatcacatacccctcccaggacgtcttcctc
gtcatacagctggagaaggtgttgcagcagggtgatataggagagtgtgcagagccctac
gtggtcttcaaagagtccgacacagccaagaacaaagagaagttggagaagttgcggagc
cagtcggatcagttctgcacacgtctgggtcggtaccggatgcccttcgcctggacagcc
atccacctgatgaacattgtgaacagcgctggtagcctggagagagacactgagctggag
atgggacttccagagaggaaagggtcatggtcggagaggaggaactcgagtgtttcgggc
cggcgctccctggagaggaccaccagtggagacgagtcatgtagtctgagcagcttcaga
cctgctaccctcaccgtcaccaacttctttaaacaggagggggaccggttgagtgatgag
gacctgtataagtttttagctgacatgaggaggccgtcttctgtactgaggagactgaga
ccaatcacagcccagctgaagattgacatctcgccggccccagagaacccccactactgc
ttgacccctgacctccagcaggtcaagccctacccagacagcagggtccgccccaccagg
gagatactggagttcccacctaaggacgtctacgtaccaaacaccacctacaggaacctg
ctgtatgtgaacccacacagcctgaacttcgccaaccgtcaaggctcagcccggaacatc
acagtgaaagtgcagttcatgaacggggaggaccccaacaacgcaatgccggtgattttt
ggcaagtcgagctgtgcagactacgccaaagaagcatacactgctgtagtgtatcataac
aggtccccagacttccatgatgaagtgaagatcaagctcccggcttctctgactgaccac
caccacatcctgttcaccttctaccatgttagctgccagcagaaacagaacacccctctg
gagacccccgtgggatacacgtggattcctatgctgcagaacggtcgtctgcgtacagga
aacttctgtctgcctgtgtctctggagaaacctcctcagtcctactctgttctctcccct
gatgttcctctacctgggatgaaatgggtggataaccacagaggtgttttcaacgttgaa
gtgacatccgtttccactgtccacacacaggaccagtacctggataagttttttgcgttg
gtccatgccttggaccacatgttccctgtgcggataggagacatgcgcatcatggagaac
aacctggaggaggagttaaagtccagcattgccgcgctgaactcctcccagctggagccc
atcgtccgcttcctccacctcctattggacaagctggtgctgctggtggtgcggccgccc
gtcatatcaggacagatagtgaacctgggccaggcgtcgttcgaggtgatggcgtccata
gtgaaccggctccataagtacttggacactagtcaggacatgcatggcagaaacagcctg
ctctcctcttacgtatactacgtcttccgcctgcccaacatggaccccaactccccctca
ccaggtccaggtctgggtggttcagtccactatgccaccatggccaggtccgcccagcga
cctgccagcctaaacctcaaccgctcccgtagccttagcaacagtaaccctgatatctct
ggcacacccacctcccctgacgatgaggtccgatccatcatcggtagtaagggcctagac
cgctccaactcctgggtgcacaccgtgcggtgtaagagcaccccctggagatccagccac
ggttctgcctctgacactgacaccgacaccatgcaggccgcggagcgctgtggcaaccgc
atgtcttcgcacactgagagcgccagtttcttgcaaactttaacaggacggttacccacc
caaaagttgttccatgaggaactggccctacagtgggtggtgagcagtggcatcgtcagg
gagggagctctacaacaggcctggttcttctttgagctgatggtgaagagcatcatccac
cacctgtacttcaccgaccggctagagtcgcccagaaagaaccgtttccccgagcgcttc
atggatgacatcacagccctggtcagcaccatcgctggggacattgtctcacgctttcag
aaggacctggagttggtggagcgtctgaacaccagcctggccttcttcctgaatgacctg
ctgtctgtcatggaccgaggctttgtcttctccctcatcaagacatactggaaacaggtg
tccactaagctgtacgtgctgcagaacccgactctggagtccctgagactcgacttcctg
aggatcatctgtagccacgagcactacgtcacacttaacctgccctgcagcctcctcacg
ccccccgcctcgccttcacccagcgtgtcatccgcaacctcacagagttctggcttctct
gcccaggaccagaagatagccaacatgtttgagttgtctgtccctttcagagagcagcac
tacctggctggtctggtgctgactgaactggctgtcatcctggacccagagggcgaagcg
atgtttggcttacataagaaggtgatcagtgtggtccataacctgctgtccagccatgac
tccgacccccgctacgctgaccctgaggtcaaggcccgtgtcgccatgctctacctgcca
ctcatcggcatcgtcatggaaacgctgccccagctgcacgacttcacagagtcccatatc
cagtggggccgccctgggggagctcaggggtccgcagatggtgccgggggggatgagtct
gtagaggacggcaacagcatgatcagtcagactgttgccatggcgatagcggggacctca
tctccgatgtcccgtcccagcagcttcctgctcaacccacaggccagtcgtccgcacgcc
accttctcagcagagtccagtcgcagtctgttgatctgtctgctgtgggttctgaagaat
gcagatgagtgtgtactacagaagtggttcactgacctgtctgtctcccagctcaaccgt
ctgctggacatgctctacctctgtgtctcctgctttgagtacaaggggaagaaggccttt
gagcgcatgaacagcctgaccttcaagaagtccaaggacatgaaggccaagctggaggag
gccatactggggagcatcggggcacggcaggagatggtccgccgcagcaggggacagcta
gagaggagtccgtcaggcagtgccttcggcagccaggaaaacctgcgctggaggaaagac
atgacacactggcgccagcacagcgagaggatggacaagagccacagatcactcaggttt
agagacagcatcctactacacagcccagggagtccaacccaaacccaggagcctttagta
gttaggacccgagcggagctggagcacgaagcacttattgacggtaacctggcaacggag
gccaatctgatcattctggacactctggagatcatcgtccaggcggtgtctgtgacagag
tcgaaggagagtatcctgggcggaatgttgaaggtgctgctccatagcatggcctgtaac
cagagtgccctctacctccagcactgctttgctacacagagggctctcgtctccaagttc
ccagagctgctgttcgagaaggagacagagcagtgtgctgacctgtgtctgcgtctactg
aggaactgtagcagcagtattggcaccatcagatcccacgcctccgcttcgctctacctg
ctcatgaggcagaactttgagattggcaataattttgctcgggtgaagatgcaggcgacc
atgtccctgtcctccctggtgggaacgtctcagcacttcaacggggaattcctccggcgt
tccctgaagaccatcttgacctacggcgaggaagacctggaactccgggagaccaccttc
cctgaccaggtccaggatctggtgttcaacctgcacatgatcctgtctgatacagtcaag
atgaaggagcatcaggaggacccagagatgctcatagacctcatgtacaggatcgctaag
ggttaccagacgtctccagacctgcgtctgacgtggatgcagaacatggcgggtaaacac
tctgagaggaccaatcacgcggaggcagcccagtgtctggtgcacagcgcggccctggtg
gcagaatacctcagcatgctggaggaccgcaagtacctgcctgtcggctgtgtcaccttc
cagaacgtctcttccaacgtgctggaggagtctgcagtgtctgacgacgtggtgtctccc
gatgaggagggtatctgctcggggaaatacttcactgaggctggcctagtggggctgctg
gatcaggctgcttcctccttctccctggctggtatgtacgaggcggtgaacgaggtgtac
aaggtcctgatccccatccacgaggccaaccgggacgccaagaagttggccaccatacat
ggtaaactacaggaagcctttggcaaaatcgtgcaccaggatgggaagagaatgtttggt
acttacttcagagtcggattttacggctctaaatttggggacttggacgagcaggagttt
gtgtacaaagagcctgccatcaccaagctagcagagatctcacaccgactcgaggggttt
tatggcgagcgctatggagaggaccaggtggaagtcattaaggactccaatccagtggac
aagtgcaaactggacccaaataaggcttatgtccagatcacgtacgtggaaccgtacttt
gacacctatgaaatgaaggaccgcatcacgtacttcgacaagaactacaacctgcggcgc
tttgtctactgcacgccgttcacgctggacgggcgtgcgcacggggatctgcacgatcag
ttcaagcgcaaaaccatcctgaccacctcccacgcattcccctacatcaagacccgcatc
aacatcatccacaaagaagagatcagctccatgcccatcgaggtggccatagaggatatg
cagaagaagacccaggagctggccttcgccacccaccaggacccctccgatgccaagatg
ctgcaaatggtcctgcaggggtctgtggggaccaccgtcaaccagggacctctggaagtg
gcccaggtgttcctttcagagatccccagtgaccctaaactctacagacaccacaacaaa
ctacgcctctgcttcaaagacttcacgaagaggtgtgaagacgccctccgtaagaacaag
agtctgattggtccagaccagaaggagtaccagagggagttggagaggaactaccatcgt
ctgaaggaggcgctacagccactcatctgcagaaagataccccagctttataaacctgtg
ctgcaggtcaactctcacagggattccttcagcagaatgagcctccgcaagcttgaactt
tga

DBGET integrated database retrieval system