KEGG   Salvelinus alpinus (Arctic char): 111971559Help
Entry
111971559         CDS       T05762                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00020  Citrate cycle (TCA cycle)
salp00640  Propanoate metabolism
salp01100  Metabolic pathways
salp01200  Carbon metabolism
Module
salp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
salp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111971559
   00640 Propanoate metabolism
    111971559
Enzymes [BR:salp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     111971559
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     111971559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 111971559
NCBI-ProteinID: XP_023854160
AA seq 324 aa AA seqDB search
MSHSRLFARLLLQQTGVRSCYTASRKNLYIDKDTKVICQGFTGKQGTFHSQQAIDYGSRL
VGGVSPGKGGRTHLGVPVFNSVKEAREGTGAEATVIYVPPPFAGAAIIEAIDAGMPLVVC
ITEGIPQQDMVKVKHKLLRQSITRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRS
GTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTDFIDCLEVFLQDPKTDGIILIGEIGGNA
EENAADYLKQHNSGANAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQQAG
VVVSMSPAQLGSTMFKEFEKRKML
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatagtagattgtttgcccggctgctcttgcagcaaactggagtaaggagctgt
tatactgcttcaagaaagaacctctacattgataaagacaccaaggtcatttgccaaggc
ttcacagggaagcaggggacgtttcacagtcagcaggcaatcgactatggctcccggcta
gtcggtggcgtatcccccggcaagggggggaggacacacctcggcgtgcccgtcttcaac
tctgtcaaggaggcgagagagggcaccggggcagaggccacagtgatctacgtgccccct
ccgttcgcgggtgccgccatcatcgaggccattgatgccggcatgcccctggtggtgtgc
atcacagagggcatcccccagcaggacatggtcaaggtcaaacacaagctgctgcgccag
agcatcacccgcctgatcggccccaactgccccggagttattaatccgggagaatgcaag
atcgggatcatgccgggccacattcacaagaaaggaaggattggcattgtctcaaggtcg
ggaactctcacatacgaagctgtgcaccagactacacaagttggcctgggacagtctctc
tgcattggcatcggtggggaccccttcaatgggacagatttcatcgactgcctggaggtg
ttcctgcaggaccccaagacggacggcatcatcctgatcggagagatcggaggcaacgcc
gaggagaacgctgccgattacctcaaacagcacaactctggagcgaatgccaagcctgtg
gtgtcttttatcgccgggctcactgccccgccgggccgtaggatgggtcacgccggtgcc
atcatcgcagggggmaagggcggagccaaagagaagattgccgccctacagcaggcgggc
gttgtggtcagcatgtcccctgcccagctgggcagcaccatgttcaaggagtttgagaag
aggaagatgttgtaa

DBGET integrated database retrieval system