KEGG   Salvelinus alpinus (Arctic char): 111971807
Entry
111971807         CDS       T05762                                 

Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:salp03021]
    111971807
Transcription machinery [BR:salp03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     111971807
SSDB
Motif
Pfam: AF-4_C
Other DBs
NCBI-GeneID: 111971807
NCBI-ProteinID: XP_023854388
AA seq 1174 aa
MLADDLKLSSDEEDADKDPEQSASWTGNNSLSEQHTHTHSGRVRRSGSDSSGSDSSGSDS
SSESEEESSSQRLRSPSPETHSDPGTPTDAQSLGCTEEADHPPTTQWQLDKWLKKVRKKS
SWDPGNREHTQRATEHSSPSPDPHRAPSPARSWGTREDYSPSQSPVPSPHFNYSPRHSPR
PSPGCSPCPSPCHSPIPSPVPSVCLSPCLSPRASRSPSPIPRHPPKSPSPSLTQSSSRHY
PQVRSLHQESFRPLTRPSLTSSPSHRPKIRIAPAPSIESKSKLRHSSSPQPPLQHSSRPK
PKQSQSVPTPKNTAKAAPALSTEPSHRPRPSPNSSPRLHSQPKLKHNPTLALKTSQHLTT
SGQRPKESCRLSHNSNSKPRPKFGPSLTTSLSPSPSPTPKAKTLPPTDPSRETSSRVGHS
SKSSPKPRSRPISKAGSGPSSRSSPSPRPKVKSRENPAPHPKPPQRKPQSREREREVDNR
RETQAADRKADRQTEGRGKGNVERQGERQGEKQGERRLAEDKLLRRPWVQSSEEEEDVEE
RKRREEREREEKRRRRKEQQRGDWQAVQPKQRPHTNSERHRNPIDPQRHGTKKKRRRKSE
EEERESQPDPSLPPSPSSPTPVIPPTDSSSSSSSSESDSEPSLPPNVAKVPADSTSSQRP
IPRRGHQGPGRPSDSRPGVLYPTATSNQEHGPQSQAKQKLYTLVPFGRSEQAPSSHRGLR
NLVVQLNLSLLSRVPDTTTDTPASHKHPSSSSSKQKEAMRHLYTPETEGGDSRRKRKTQS
PTQVYTKDESTRVNSHTNGPSAHTESTANRESTRSNSHTNGPSAHTESTANRCLDPHKDA
RHNRFLEDYLDSKRPLSPLSPLSDTPDPTKPPIKTQPPVRHYTNSEVPRTHAKMEVECVG
VSGKPPPMCESWGPPLQRAGSQRGTVLNHEPPHHAEYYMHEAKRMKHRADAMVDKLGKAV
NYVDAALSFMECGKAMEEGPLEDKSPYSMYTETVELIRYAMRLKNHSGPGARQEDKQLAV
LCFRCLALLYWQMFRLKKDQAMKYSKALLDYFKSSPKVPTTPPIWSDSGKGTGGPPSSLS
PSPSALPLGSSPSSLINIPLRIHQMAANHLNITNNVLYSYEYWELAESLVRDNNEFFNYL
NTLSGPLTLHSSIAHAVQYTRQGLQWIRISANVG
NT seq 3525 nt   +upstreamnt  +downstreamnt
atgctcgctgatgacttgaagctcagcagtgacgaggaggatgctgacaaggaccctgag
cagtcagcctcctggactggtaacaatagtctgtcggagcagcacacacacacacatagt
gggagggtgagacgttcaggctcagactcttcaggctcagactcttcaggctcagactcc
tccagtgagtcggaggaggagagcagtagccagcgccttcgtagccccagcccagaaaca
cactccgatcctgggacacccaccgacgctcagtccctcggctgcaccgaggaggcagat
cacccccccaccactcagtggcagctggataagtggctgaagaaagtcagaaaaaaatcc
tcctgggatcccggcaaccgtgagcacacccagagagctacagaacacagctcgccctcc
ccagaccctcacagagccccgtctccggccagatcctgggggaccagagaggactacagc
cccagccagagccctgttcccagcccacacttcaactacagccccaggcatagccctcgg
cctagccctggctgcagcccctgtcccagtccttgccacagccccatccctagcccggtc
cccagtgtctgtctgagcccctgcctcagccccagagccagccgcagccctagccccata
ccccgacacccccctaagagtcctagtcccagccttactcagtctagctcccgtcactat
cctcaggttcggagtcttcatcaggaaagcttcaggcctctcacgcggcctagcttaaca
tccagcccgagccatagacccaaaatcaggatcgcacctgctcccagcattgagtccaag
agcaaactgaggcacagttcctctccccagcctccgcttcagcacagctccaggcctaaa
cccaaacagagccagtctgttcccactcccaagaacacagccaaggcagcccctgctctg
agcactgagccgagccacagacccagacctagtcccaactccagtcccaggcttcattct
cagcctaagttgaaacacaaccccaccctagccctcaaaaccagccaacatctaacaacc
tctggacaaagacccaaggagagttgcagactcagccacaattccaactccaaacccagg
cccaagtttgggcctagtttgacaaccagcctcagtcccagtcccagtcccacacccaag
gccaagaccttacctcccacagaccctagcagagagaccagcagcagagttggtcacagt
tccaaatcgagtcccaagccacgttctcggccgatctccaaagctggttctgggcctagc
tctagatccagccccagtcctagacccaaagtcaaatcccgggagaaccctgctccccac
ccaaagcctccacagaggaagccccaatccagggagagagaacgggaggtggacaaccgg
agagagacccaggcagcagacaggaaggcagacaggcagacagagggaagggggaagggt
aatgtagagagacagggagagaggcagggggagaaacagggagagagaagactggcagag
gataagttgctaagacgcccctgggtccagagttcagaggaggaagargacgtagaggag
agaaagaggagggaggagagagagagggaggagaagaggaggaggaggaaggagcagcag
agaggggattggcaggcggtccagcccaagcagagacctcacaccaacagcgagcgacac
cgcaatcccattgatccacaacgccacgggaccaagaaaaagaggaggaggaagagtgag
gaggaagagagagagtctcaaccggacccttcccttccgccgtcgccctcctcccccaca
cctgtcatccctcccacagattcctcttcatcatcttcctcatcagagtccgactcggag
cccagtctgcctcccaacgtcgccaaagtcccagccgactccacgtccagccagcgtcct
atccccaggagagggcaccagggccctgggaggccttcagacagtaggccaggagtgctc
taccccactgccacatccaaccaagagcacgggccgcagagccaggcaaagcagaaactc
tacaccttggtcccgtttgggcgtagtgagcaggccccatcctcacatcgaggcctgagg
aatctggtggtgcagttaaacctctccctgctcagcagagtgcctgatactacgacagac
accccagcctctcacaaacacccctcctcttcctcttccaagcaaaaagaggccatgaga
cacctgtacaccccagagacagagggaggagacagcaggaggaaacggaagacacaatcg
cccacacaagtctacactaaagacgagagtacccgagttaactcccacaccaacggcccc
tcagcccacacagagtctacagctaacagagagagtacccggagtaactcccacaccaac
ggcccctcagcccacacagagtctacagctaacagatgtctagacccccacaaagatgcc
agacacaacaggttcttggaggactacctagacagtaagaggccactgtcccccctgtcc
cctctctctgacaccccggaccccaccaagcctcccatcaaaacacagcccccagtgcgg
cactacacaaacagtgaggtgcccaggacccatgctaagatggaggtggagtgtgtaggc
gtgtcagggaagcccccgcccatgtgtgaatcctggggacctcctttacaacgggcaggg
agccagagaggaactgtactcaaccatgaacccccacaccatgctgagtactacatgcat
gaggccaagagaatgaagcaccgtgcagatgccatggtggataagctggggaaggcagtg
aactatgtggatgctgctctctccttcatggagtgtggcaaagctatggaggagggaccg
ctggaggacaagtctccctacagcatgtacacagagacggtagagctcatcaggtatgcc
atgaggctgaagaaccactctggtcctggggccagacaggaagacaaacagctggccgta
ctctgtttccggtgccttgctctcctgtactggcagatgtttcgtctgaagaaggaccaa
gccatgaagtactccaaagctctactggactactttaagagttctcccaaagtgcctact
acaccccccatctggagcgactcgggaaagggcacaggggggcctccctcctctctctcg
cccagcccctcagccctccccctgggcagctccccctcttccctcatcaacattcccctg
cgtatccaccagatggcagcaaaccacctgaacatcaccaacaatgtcctatacagctac
gagtactgggaactagcagaaagcctggtcagagacaacaatgagttctttaactacctg
aatacactgtcagggccattgactctccacagtagtattgctcatgcagtccagtacacc
agacagggtctgcagtggatacgcatcagtgccaacgtgggctag

DBGET integrated database retrieval system