KEGG   Salvelinus alpinus (Arctic char): 111972384Help
Entry
111972384         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00514  Other types of O-glycan biosynthesis
salp00515  Mannose type O-glycan biosynthesis
salp00533  Glycosaminoglycan biosynthesis - keratan sulfate
salp00601  Glycosphingolipid biosynthesis - lacto and neolacto series
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    111972384
   00514 Other types of O-glycan biosynthesis
    111972384
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    111972384
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    111972384
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:salp01003]
    111972384
Enzymes [BR:salp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     111972384
Glycosyltransferases [BR:salp01003]
 Terminal extension
  Sialyltransferase
   111972384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 111972384
NCBI-ProteinID: XP_023855202
AA seq 364 aa AA seqDB search
MRIMKPTRHLLLVLCPMVVLGFLYYSSGRLHPWGWGHKSLYDKQGFLLKLDGNLPLELMY
KYGNLSEGVCKPGYAAAKMTAIYPKFTKPAPMFLDPNFRRFNKISKFFPPFGIKMQEKII
DNILTATKSYGLEDELDSLSCKKCIIMGNGAILTNKSMGAWIDEYNVIARLNEAPVSGYE
KDVGSRTTMRITYPEGAIQKTERYEQDSLFVLSAFKALDFKWLRSMIFKDRLHSTDGFWK
SVARHVPREPSEMRILNPYFIQEAAFRFIGLPHNNGQMGRGNIPTLGTVAITMALHNCDE
VAVAGFGYDMSTPHAPLHYXEKIRMAAIKQSWTHNISKEKEFLIKLVKAGVIQDLTRGIC
GSGC
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcatgaagccaacccgtcacctgctcctggtgctttgtcccatggtggtcctg
ggcttcctctactactcctctgggagactgcacccctggggctggggacataaatcactg
tatgacaaacagggattcttgctgaagttggatggtaatctgcctttggagctgatgtac
aagtatggcaatctcagcgagggagtctgcaaacctggctatgcagctgccaagatgact
gccatttatccaaagttcactaaaccagcccccatgttccttgatccgaattttagacga
ttcaacaaaatcagcaaattcttcccaccttttggaataaaaatgcaagaaaagatcata
gataatattctgacagccacaaagagctatggtctggaagatgagctggacagtctgagt
tgtaaaaagtgcatcatcatgggaaatggtgctattctgaccaacaagtctatgggtgca
tggattgacgagtacaacgtgattgcaaggttgaacgaggctccagtgagtggctatgag
aaagatgtgggctcccggaccactatgcgtatcacctacccagagggagccatccagaag
actgaacgctacgaacaggactccctcttcgttctctctgccttcaaagctctcgacttc
aaatggctgcggtccatgatctttaaagataggctgcatagtacagatgggttctggaag
tctgtggcccgtcatgtccccagggagcccagtgagatgaggatcctcaacccttacttc
atccaggaggctgccttcaggttcattggcctgccacacaacaayggacagatggggaga
gggaatattccgacactggggactgttgccattacaatggccctccataactgtgatgag
gtagccgtggctggatttggttatgacatgagtaccccccacgcccccctacactactar
gagaagatcaggatggcagccatcaaacagtcctggactcataacatttctaaagagaag
gagttcctgattaagctggtgaaggccggggttatacaggacttgacccgtgggatctgt
ggctcagggtgctga

DBGET integrated database retrieval system