KEGG   Salvelinus alpinus (Arctic char): 111973080Help
Entry
111973080         CDS       T05762                                 

Definition
(RefSeq) cAMP-responsive element modulator isoform X1
  KO
K09052  cAMP response element modulator
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:salp00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111973080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:salp03000]
    111973080
Transcription factors [BR:salp03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111973080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 111973080
NCBI-ProteinID: XP_023856037
AA seq 111 aa AA seqDB search
MAVAGDETESASTGDMSGYQICTPTSSLPQGVVMAGSPGSLHSPPHVADETTRKRQLRLM
KNRQAAKECRRRKREYIRCLETRLTMLEAQNKKLMDELNYFKEMYGIKSSQ
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgctggggatgagactgagtcagcttccactggtgacatgtcaggctaccag
atctgcactcccacctccagcctgccccagggcgttgtgatggctggctcaccaggctct
ctgcacagccccccacacgtggctgacgagaccacacgcaagagacaactccgcctcatg
aagaacaggcaggcagccaaagagtgccggcggaggaagagagagtatattcgctgtctg
gagactcgcctcaccatgctggaggcccagaacaagaagctcatggatgagctaaactac
tttaaggaaatgtatgggattaagtcgagtcagtaa

DBGET integrated database retrieval system