KEGG   Salvelinus alpinus (Arctic char): 111974442Help
Entry
111974442         CDS       T05762                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111974442
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:salp04030]
    111974442
G protein-coupled receptors [BR:salp04030]
 Rhodopsin family
  Lipid
   Leukotriene
    111974442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv CD34_antigen
Motif
Other DBs
NCBI-GeneID: 111974442
NCBI-ProteinID: XP_023857923
AA seq 237 aa AA seqDB search
MLNLALCDLMVLLCLPLVINNLQRTWDLGPAACKLLFFLIYCSLNGSVLTITLLSVQRCV
QVLYPHSWARLGRMREGHSSLWGLAGFIASPAFSVLDIKTYDGGKSCSSHFQSLRQEMAI
LLVQMLLGFVVPCCILVASYFYLHRRVSQAALFRQRRVTKLVICIVLSFFCFWTLLHLFN
LLALVNLAVQNEVVENVCDSAWNVLMGFIIINSSLNPFLYAFTSSGIPRASPHPTTT
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatctggcactgtgtgacctgatggtcttgctatgcctgcctctagttatcaac
aacctacagaggacctgggatctgggccccgccgcctgcaagctgctcttcttcctgatc
tattgcagcctgaatggtagtgtgctgaccatcaccctgctgagtgtgcagcgctgcgtc
caggtgctgtacccccacagctgggcgcggctaggccgtatgagggaagggcactcctcc
ctgtgggggctggcagggttcattgcctctcccgccttctctgtccttgacatcaagaca
tacgacggtggcaaatcctgcagctcacacttccagagcctcagacaagaaatggccatc
ctacttgtccaaatgctgctgggatttgtagttccctgctgcatcctggtggcgtcctac
ttctacctccacaggagggtgagccaggcggccctgttcaggcagcggagggtgaccaag
ctggtcatctgcatcgttctgtccttcttctgcttctggactctgctgcacctgttcaac
ctgctggccctggtgaacttggccgtgcagaacgaggttgtggagaatgtgtgtgactca
gcttggaatgtcctcatgggtttcatcatcatcaacagctccctcaaccctttcctctat
gccttcacctcttcaggaatccccagggcaagcccccacccaaccaccacatga

DBGET integrated database retrieval system