KEGG   Salvelinus alpinus (Arctic char): 111976670Help
Entry
111976670         CDS       T05762                                 

Definition
(RefSeq) mitogen-activated protein kinase 12-like isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04068  FoxO signaling pathway
salp04114  Oocyte meiosis
salp04218  Cellular senescence
salp04261  Adrenergic signaling in cardiomyocytes
salp04370  VEGF signaling pathway
salp04620  Toll-like receptor signaling pathway
salp04621  NOD-like receptor signaling pathway
salp04622  RIG-I-like receptor signaling pathway
salp04625  C-type lectin receptor signaling pathway
salp04912  GnRH signaling pathway
salp04914  Progesterone-mediated oocyte maturation
salp04933  AGE-RAGE signaling pathway in diabetic complications
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111976670
   04370 VEGF signaling pathway
    111976670
   04068 FoxO signaling pathway
    111976670
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111976670
   04218 Cellular senescence
    111976670
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111976670
   04621 NOD-like receptor signaling pathway
    111976670
   04622 RIG-I-like receptor signaling pathway
    111976670
   04625 C-type lectin receptor signaling pathway
    111976670
  09152 Endocrine system
   04912 GnRH signaling pathway
    111976670
   04914 Progesterone-mediated oocyte maturation
    111976670
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111976670
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111976670
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111976670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    111976670
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111976670
Protein kinases [BR:salp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111976670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 111976670
NCBI-ProteinID: XP_023861447
AA seq 359 aa AA seqDB search
MESPVKTGFHRLEIKKTTWDVPEQYIALKAVGSGAYGTVCSAIDQQTKEKVAIKKLYRPF
QSLIHAQRAYRELRQLRHIQHDNVISLLNVFTPDFSLEKFQTFYMVMPFVAQDLGRIMKS
RRLNDRIIVYLFYQLLRGLKYIHSAGIIHRDLKPGNLAVNENCELKILDFGLARHAESEM
TGYVVTRWYRSPEVIFNWMHYSQSVDLWSAGCILAEMITGQVLFPGNDSIDQLKKILNVT
GTPPSSLVQKMQSKDARSYVQSLPIQKKKNFKEVFPSLHVNAVNLLENMLLLDPETRMTA
KEGLSHPYLAEFHDPESEPDSPTYDDSFESLELDVGEWSSLIHMEIMAFDPSNPSATAL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgcctgtgaagacaggtttccatagactggagataaagaaaacaacatgggat
gttccagagcaatatatcgcgctgaaagcagttggctcgggcgcttacgggacggtatgt
tctgctattgaccagcagactaaggagaaggtggccataaagaagctctatcgtcccttt
cagtccctaatccacgctcaacgggcctaccgtgaactaagacagttacgccatatccag
catgacaatgtgatcagcctcctcaatgtcttcacacctgatttctccctggagaaattc
cagacgttttacatggtaatgccctttgtggctcaggacctcggtcgcatcatgaagagc
aggagactgaatgatcgcatcatcgtttacctcttctaccagctgctacgtggcctgaag
tatatccattctgcagggatcatccatcgggacctaaaacctggcaaccttgctgtgaat
gagaactgtgaattaaagatcctggactttggtctagcaagacatgcagagagtgagatg
acaggctatgtggtgacacgctggtacaggtcaccagaggtcatcttcaactggatgcac
tatagccaatcagtggacttgtggtctgcaggctgcatcctggctgagatgatcacaggc
caggttcttttcccaggcaatgacagcattgaccagctgaagaagatcctcaacgttaca
ggaacaccaccatcctccctggtgcagaagatgcagagcaaagatgctcgctcatatgta
cagagtctccctatccaaaagaagaaaaacttcaaggaggtctttccctccttgcatgta
aacgcggtgaatctgctggagaacatgttgctgctggacccagagaccaggatgacggct
aaagagggcctctcacacccctacctcgctgagttccatgacccagaatctgaacccgac
tccccgacgtacgacgactcctttgaaagcctggagcttgacgtgggagagtggagtagt
ctgatccacatggagattatggctttcgaccccagtaaccccagtgcaactgcattgtag

DBGET integrated database retrieval system