KEGG   Salvelinus alpinus (Arctic char): 111977796Help
Entry
111977796         CDS       T05762                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:salp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111977796
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:salp03041]
    111977796
Enzymes [BR:salp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111977796
Spliceosome [BR:salp03041]
 Complex C
  Other components
   Step II factors
    111977796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 AAA_16 AAA_30 ABC_tran PhoH Flavi_DEAD Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 111977796
NCBI-ProteinID: XP_023863236
AA seq 1222 aa AA seqDB search
MLLFSSEHKTVSWIMSHIGDNELEQLEYLSLVSKVCTELDNHLGISDKDLAEFVISLAEK
QPTFXGFKSLLLKNGAEFTDSLVGNLLRLIQTMRPPPKASTSKAFEPVVKQKNDKDKLKE
LFPALCRPDDPAPKAILDEDDVKIADAAMKELEMFMPSVSRSDSKSKSRSDKKRRHSRSR
SRDRDRRRRHRSRSRSRSRSRSRDRDRQRERDRERDRDRGKKRASRWSERSRTPSPHRDR
DRDTKEGSDRWKDKHVDRPPPEEPTVGDIFNGKITSIMQFGCFVQLEGLRKRWEGLVHIS
ELRREGRVANVADVVQKGQRVKIKVLSFTGSKTSLSMKDVDQETGEDLNPNRRRNQGPDG
EEEKIMRNPDRPTNLNLGHAPELEDDTLERKRLTKISDPEKWEIKQMIAANVLSKEEFPD
FDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPVKIVKNPDGSLSQAAMM
QSALAKERREVKQCQREAEMDSIPMGLNKHWVDPLPDVDGRQIAANMRGIGMMPTDIPEW
KKHAFGGNKASYGKKTAMSILEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQI
TQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVI
KYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSA
TLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDVLV
FLTGQEEIDTACEILYERMKSLGPEVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIA
TNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDHLVVTPISQAQAKQRAGRAGRTGPGK
TYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAM
EQLYTLGSLDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVF
YRPKDKQALADQKKAKFHQAEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDI
RKQMLGIMDRHKLDVVTCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPS
SALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFSPAFFKVSDPTRLSKQKKQQRL
EPLYNRYEEPNAWRISRAFRRR
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgttttcttctgaacacaaaacwgtctcttggataatgtcacacatcggcgat
aacgagctagaacaactggaatacctctcgttggtatccaaagtgtgcacagaactcgac
aaccatttggggataagtgataaagatctagctgagtttgtcatcagccttgctgaaaaa
caaccaacatttgawggcttcaaatcacttctgctgaaaaatggagcagaattcacagat
tcactcgtcggcaatttgctcagacttattcaaacgatgcggcctccaccaaaggcatct
acaagcaaagcctttgaacctgtggtcaagcagaagaatgacaaggacaaactgaaggaa
ttgtttcctgcattatgcaggccagacgatcctgctcccaaggccatattggatgaagac
gatgtgaagatcgccgacgctgccatgaaggagttggagatgttcatgcccagtgtgagc
agatcagactcaaagagcaagagcaggtcggacaaaaagaggaggcacagcagaagtcgy
agccgagaccgggacaggaggcggcgtcaccgttctcggtcccgctcacgctctagatct
cgctctagggaccgcgaccgtcagagagagagagaccgrgagagggaccgcgaccgtggt
aagaaacgtgcgtctcgctggagtgagcgcagtcgtacccccagcccccacagagaccgg
gacagggacacaaaggaaggctctgaccggtggaaggacaaacacgtggatcgccctcca
ccagaggagcctactgtgggggacatcttcaatggcaaaatcaccagcatcatgcagttt
ggctgcttcgtgcaactggaggggctgaggaaacgctgggagggcttggtccacatctcc
gagctgcgcagagagggacgcgttgccaatgtggctgatgtggtccagaaaggtcaaagg
gtcaagatcaaggtgctgtccttcactggctccaagaccagtctcagtatgaaggatgta
gaccaggaaacaggggaggacctgaaccccaaccggaggaggaaccagggccctgatggt
gaggaggagaaaatcatgaggaaccccgaccgcccaaccaacctcaacttgggccacgcc
cctgagttggaggacgacacactggagcgcaagaggctgaccaagatatctgaccccgag
aagtgggagatcaaacagatgattgctgctaatgttctttctaaagaggagttccctgac
tttgatgaggagaccggtatcctccccaaagtagatgacgaagaagatgaggacctggag
attgagctggtggaggaggagcctccgttcctgagaggacacactaaacagagtatggac
atgagccctgtcaagattgtcaagaatccagatggctcgctgtcccaggcagccatgatg
cagagtgctttggctaaggagaggagggaagtgaagcagtgtcagcgagaggccgagatg
gactccatccccatgggcctgaacaaacactgggtagaccccctgcctgacgttgatggg
agacagattgcagccaacatgagaggcatcggcatgatgccaactgacatcccggagtgg
aagaaacatgcctttgggggcaacaaggcctcttatggcaaaaagacagcgatgtccatc
ctggagcagagagagagcctgcccatctacaagctgaaagaacagctcatacaggctgtc
cacgataaccagatcctgattgttattggagagactggctctgggaaaaccacccagatc
acccagtacctggccgaggcaggctacaccactcgggggaagatcggctgcactcagccc
cgtcgtgtggcagccatgtccgtggccaagagagtctctgaagagtacggttgctgtctg
ggccaggaggttggatacaccattcgttttgaggactgcaccagccctgagacggtgatt
aagtacatgacagacggtatgttgctgagagagtgtctgatagatccggaccttggccag
tacgccatcatcatgttggatgaggcccatgagaggaccatccataccgacgtactcttc
ggtctgctcaagaagacggtgcagaaacgcacggacatgaaactcattgtgacttcggcc
acacttgatgccgtcaagttctcmcagtacttctacgaagcgcccatcttcaccatccca
gggcgtacctacccagtggaggtgctctacaccaaagaacccgagacagactacctggat
gccagtctcatcaccgtcatgcagatccacctgactgagcctccaggtgacgtcctggtg
tttctgacgggccaggaggagatcgacaccgcttgtgagatcttgtatgaacggatgaag
tcactgggacctgaagtgcctgaactcatcatcctaccggtctactccgccctgcccagc
gagatgcagacccgtatctttgaccctgctccccccggcagcagaaaggtcgtcattgcc
actaacattgctgagacgtctctgaccatcgacggtatctactatgtggtggacccaggc
tttgtgaagcaaaaggtgtacaactccaagactggtattgaccayctggtggtgaccccc
atctcacaggcccaagccaagcagcgggctggaagagctggaagaactggtccagggaag
acctacaggctgtacacagagagagcctacagagacgagatgctcaccaccaacgtgcct
gagatccagagaactaacttggccagcactgtgctgtctctcaaggctatgggcatcaat
gacctgctgtcgtttgacttcatggacgcgccacccatggagacgctgatcacggccatg
gagcagctctacactctggggtctctggacgatgaagggttgctcactcgccttggacgc
aggatggccgagttccctctggagcccatgctgtgtaagatgctgatcatgtccgtccac
ctgggctgcagtgaggagatgctcaccatcgtctccatgctgtctgtgcagaacgtcttc
tacaggcccaaggacaagcaggccctggctgaccagaagaaggccaagttccaccaggcc
gaaggagaccaccttaccctgctggctgtgtataactcctggaagaacaacaagttctcc
aacccttggtgctatgagaacttcatccaggcccgctccttgcgcagagcccaggacatc
cgcaaacagatgttgggcatcatggacagacataaactggacgtggtgacttgtggaaag
gccacagtgcgtgtycagaaggccatctgcagtggtttcttccggaacgcagccaaaaaa
gatcctcaggaaggctaccgtaccctcattgaccagcaggtggtgtacatccacccctcc
agtgccctgttcaaccgccagcctgagtgggtggtgtaccacgagctggtgctgaccacg
aaagagtacatgagggaagtgaccaccattgacccacgctggctggtagagttctcgccg
gccttcttcaaagtgtccgaccccacacgcctcagcaaacagaagaagcagcagcgcctc
gagcccctctataaccgctacgaggagcccaacgcatggagaatctcccgcgccttccgt
cggcgctag

DBGET integrated database retrieval system