KEGG   Salvelinus alpinus (Arctic char): 111977848Help
Entry
111977848         CDS       T05762                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00010  Glycolysis / Gluconeogenesis
salp00562  Inositol phosphate metabolism
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111977848
   00562 Inositol phosphate metabolism
    111977848
Enzymes [BR:salp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     111977848
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     111977848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 111977848
NCBI-ProteinID: XP_023863346
AA seq 461 aa AA seqDB search
MTTALSKQSLLFMTFSLALTRFSYCSVANANVNSNIAAIANHFGTKGRYEEVNRYLINDI
LSVNKSILKPVCTNSTAIHVTAIIRHGTRYPSTKNIKIMQRLYDLVLNEAMNTDKWLKDI
KTKWEMWYTDDMDGKLVEKGRDDHRHLAVRLATLFPSLISEENLRAHRIRFITSSKHRCV
DSIVAFQEGLLNLWKVTEVGPSHKINDELMRFFDQCQKFVEDVENNQTALEEVHLFKASA
EMKRVQMKMADQLQVPYNRITPDLVEAAFFLCSYEFAIKSLNSAWCNLFDETDAQVLEYK
NDLKQYWKRGYGHDINRKSSCNLFHDLFNRLDQAAREIRFGHVSEAVSIQVGHAETLLPL
LALMGFFRDETALTADNFDVQNGRTFRTSRIVPYAANLLFVLYDCSEGLRLQFLLNETPQ
NFPDIMHQAPLYDMVRETYRELLQGCNFEKECELSSPNSEF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgcgttatctaaacaaagtttgttgttcatgacatttagtcttgctttgacc
aggttttcatactgctcagttgcaaatgctaacgtcaattcaaacatagctgcgattgca
aatcattttggaacgaaaggcagatatgaggaggttaaccgttatctcattaatgacatt
ctctcggtaaacaaatccattttaaaaccagtatgtaccaatagcacggctattcatgtg
accgctattattcggcatggtacacgatatccatcgaccaaaaatataaaaattatgcaa
cggctttacgaccttgttctaaacgaggcaatgaatactgataaatggctgaaggatatc
aaaaccaagtgggaaatgtggtacactgacgacatggatggcaagcttgtggagaagggg
cgagatgaccataggcatctggctgtcaggttggcaacactgtttccatctctgatatcc
gaggaaaacctcagagcccaccgtatccgtttcatcactagctctaaacacagatgcgtg
gacagcattgtagcatttcaagagggcctactcaacctttggaaagtgacagaagttgga
cccagccacaaaatcaacgatgagttgatgaggttctttgaccagtgtcagaaatttgtt
gaggacgtagagaacaaccaaactgccctggaagaggtccacctcttcaaggcctcagca
gagatgaaaagagtgcagatgaagatggctgaccagctgcaagtgccatacaatcgcatc
acaccagatctggtggaggctgcattcttcctgtgctcatatgagtttgccatcaaatct
ttgaactctgcctggtgcaacctgtttgatgagactgacgcccaagtgctggagtacaaa
aatgacctgaaacagtactggaagaggggctatggtcatgatatcaaccgcaagtccagt
tgcaatctctttcatgacctgttcaatcgtcttgatcaggctgctcgtgagatcaggttt
gggcatgtatctgaggctgtgagcatccaggtgggtcatgccgagaccctcctgcccctg
ttggccctcatgggcttcttcagagacgagacggccctgactgctgacaactttgacgtg
caaaatggccgcaccttccgtaccagccgcattgtgccttacgcagccaacctgctcttt
gtgctgtatgactgcagcgaaggactccggctacagttcctcctcaacgagacacctcag
aacttccctgacataatgcaccaggctccactctacgatatggtcagagagacctacaga
gagctgctgcaaggctgcaattttgaaaaagagtgcgagctgtccagtcccaactctgag
ttttga

DBGET integrated database retrieval system