KEGG   Salvelinus alpinus (Arctic char): 111978232Help
Entry
111978232         CDS       T05762                                 

Definition
(RefSeq) fructose-bisphosphate aldolase A
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00010  Glycolysis / Gluconeogenesis
salp00030  Pentose phosphate pathway
salp00051  Fructose and mannose metabolism
salp01100  Metabolic pathways
salp01200  Carbon metabolism
salp01230  Biosynthesis of amino acids
Module
salp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
salp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111978232
   00030 Pentose phosphate pathway
    111978232
   00051 Fructose and mannose metabolism
    111978232
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:salp04131]
    111978232
   03036 Chromosome and associated proteins [BR:salp03036]
    111978232
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:salp04147]
    111978232
Enzymes [BR:salp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     111978232
Membrane trafficking [BR:salp04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    111978232
Chromosome and associated proteins [BR:salp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111978232
Exosome [BR:salp04147]
 Exosomal proteins
  Proteins found in most exosomes
   111978232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 111978232
NCBI-ProteinID: XP_023863948
AA seq 363 aa AA seqDB search
MPHAFPFLTPDQKKELSDIALKIVAKGKGILAADESTGSVAKRFQSINAENTEENRRLYR
QLLFTADDRAAPCIGGVIFFHETLYQKTDAGKTFPEHVKSRGWLVGIKVDKGVVPLAGTN
GETTTQGLDGLYERCAQYKKDGCDFAKWRCVLKITSTTPSRLAIMENCNVLARYASICQM
HGIVPIVEPEILPDGDHDLKRTQYVTEKVLAAMYKALSDHHVYLEGTLLKPNMVTAGHSC
SHKYTHQEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASINLNVMNQCPLHRPWALTF
SYGRALQASALKAWGGKPANGKAAQEEFIKRALANSLACHGKYVASGDSTAAGESLFVAN
HAY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacgcgttccccttcctcactcctgatcagaagaaggagctcagtgacatcgct
ctcaagattgtcgccaagggcaagggaatcctcgccgctgacgagtctaccggcagcgtt
gccaagcgcttccagagcatcaatgctgagaacactgaggagaacaggaggctgtaccgt
cagctcctcttcaccgccgacgatcgcgccgccccttgcattggtggcgtcatcttcttc
cacgagaccctgtaccagaagaccgatgccggcaagaccttccccgagcacgtcaagtcc
agaggctggcttgtaggcatcaaggttgacaaaggtgttgtccccctcgctggaaccaac
ggagagaccaccacccagggtctggatggcctgtatgagcgttgcgcccagtacaagaag
gacggttgtgacttcgccaagtggcgttgtgtgctgaagatcacctccaccaccccctcc
cgcctggccatcatggagaattgcaatgtcttggctcgttatgccagtatctgccagatg
cacggcattgtccccattgttgagcccgagatcctccccgacggtgaccacgacctgaag
cgcacccagtacgtgactgagaaggtcctggccgcaatgtacaaggctctgtccgaccac
catgtctacctggagggtaccctcctgaagcccaacatggtcactgccggacactcctgc
tcacacaagtacacccaccaggagatcgccatggccaccgtcacggccctgcgccgcacc
gtgcccccagcagttcccggcgtcaccttcctgtccggtggccagtctgaggaggaggca
tccatcaacctgaacgtcatgaaccagtgtcccctgcacaggccatgggcattgactttt
tcctatggccgtgccctccaggcatccgccctgaaggcatggggtggcaaacctgcgaac
ggcaaggctgcccaggaggagttcatcaagagagctctggccaacagcctggcctgccay
ggcaagtatgtcgcttccggagacagcaccgccgctggagaatcactgttcgtggccaac
cacgcttattag

DBGET integrated database retrieval system