KEGG   Salvelinus alpinus (Arctic char): 111978723Help
Entry
111978723         CDS       T05762                                 

Definition
(RefSeq) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00140  Steroid hormone biosynthesis
salp01100  Metabolic pathways
Module
salp_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
salp_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    111978723
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     111978723
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     111978723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_10 NmrA RmlD_sub_bind KR
Motif
Other DBs
NCBI-GeneID: 111978723
NCBI-ProteinID: XP_023864717
AA seq 374 aa AA seqDB search
MSLQGDVCVVTGACGFLGERLVRLLLEEDKLTEIRMLDIHVRPQLIQCLEEIRGDTLVSV
FEGDISDSELLRRACKGASLVFHTASLIDVTGKVVYSELHRVNVKGTQLLLETCVQENVV
SFIYTSSIEVAGPNANGDPIINGDENTPYTCSLKFPYSKTKKEAEQVTLQAQGEVLQNGG
RLATCALRPMYIYGEGCRFLLGHMGDGIRNGDMLYRTSRPEAQVNPVYVGNAALAHLQAA
RALRDPQRRAAIGGNFYYISDDTPPVSYSDFNHAVLSPLGFSIQEKPILPIPVLYLFCFL
MEMLQILLCPFKRFTPPINRQLLTMLNTPFSFSYRRAQRDMGYAPRYSWEEARKRTMDWV
ASQLPKERERSKAK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgcaaggtgatgtgtgtgtggtgacaggagcctgtgggttcctgggagagagg
ctggtccgactgctgctggaggaagacaagctcacagagatccgtatgctggacatacat
gtccgaccacaactcatacagtgtctggaagagatcagaggggacacgctggtaagtgta
tttgagggggacattagtgatagtgagctgctgaggagagcgtgcaagggagcatcgcta
gtcttccacactgcgtccctcatagacgtcaccgggaaggtggtctacagtgagcttcac
agggtcaacgtcaaaggaacccagctccttctggagacatgcgtccaggagaatgtggtg
tccttcatctacaccagcagcatcgaggtggccggccccaacgccaacggagaccccatc
atcaacggtgatgagaacacaccctacacatgctccctaaagttcccctacagcaagacc
aagaaggaggccgagcaggtcacactgcaagcccagggtgaggtgctccagaatgggggc
cggctggccacctgcgccctccgacccatgtacatctatggagagggctgccgtttcctg
ctgggccatatgggagacgggattcggaacggggatatgttgtaccggacctcccgcccg
gaggcccaggtgaaccctgtatacgtggggaatgcggccctggcccacctccaggccgcc
cgcgctctgcgagacccccagcggagagccgccatcggagggaacttctactacatctca
gacgacacgccgcctgtcagctactctgacttcaaccatgctgtgttgtcgccgctgggc
ttcagcatccaggagaagcctatcctgcccatcccagtcctctacctcttctgtttcctc
atggagatgctgcagatactgctctgccccttcaagcgcttcacaccgcccataaaccgg
cagctcctcaccatgctgaacacgcccttcagcttctcctatcggagggctcagagggac
atggggtacgccccacggtacagctgggaggaggcacgcaagcggaccatggattgggtg
gcttcccagttacccaaggagagagagagaagtaaggcaaaataa

DBGET integrated database retrieval system