KEGG   Salvelinus alpinus (Arctic char): 111979037Help
Entry
111979037         CDS       T05762                                 

Definition
(RefSeq) rho-associated protein kinase 1 isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04270  Vascular smooth muscle contraction
salp04350  TGF-beta signaling pathway
salp04510  Focal adhesion
salp04530  Tight junction
salp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111979037
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111979037
   04530 Tight junction
    111979037
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111979037
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111979037
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    111979037
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:salp03036]
    111979037
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111979037
Protein kinases [BR:salp01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   111979037
Chromosome and associated proteins [BR:salp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111979037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding HR1 PH C1_1 Cortex-I_coil APH Pkinase_C
Motif
Other DBs
NCBI-GeneID: 111979037
NCBI-ProteinID: XP_023865092
AA seq 1386 aa AA seqDB search
MSSGESLEARFEKIDAMLKDPKSEINTDCLLDGLDALVYDLDFPALRKNKSIDNFLNRYK
DTISKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKATRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSAWVVQLFYAFQDDRNLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDGIHAMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKDGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNALTFP
DDSDISKDAKNLICAFLTDREVRLGRNGVDEIKRHPFFKNDQWTWENIRDTAAPVVPELS
SDIDTRNFDEIEADRGDEETFPIPKAFVGNQLPFVGFTYYSSHQFSRSSXTKSVDKRSSS
TKEDKSHLENLQKRIYQLEEQLHSEMQLKDEMEQKCRTSNTKLDKIMKELDEEGNVRKGV
EASMSLLEKDKMMTQHRATEYQRKADQEAEKRRNLENEVSTLKEQLEDMRKICQNSQASN
DKILQLQNQLEEANDLLRAESDTAARLRKSHTEMAKSMSQLEGLNRELQEKSRSSDGGRA
QLEKELXQLQSTLDSERRCYSQGSEEIHELQVRMTGFQEDNKNLELSLSKVEAERKQAQE
XRNNLEKEKNNLEIDLNYKLKTLQHRLDQEHTEHRVTRAQLTDKYESIEEAKSAAMHAVQ
QKVSEESGARMRAESRVVEVEKQCSMLEFDLKQSVQKMEQLMKQKERLEDEVKGLRMQLE
QESSKRLLAQNELKCRSQEADRLKSSEKQLKQEINTALESKRSLEFQLAQLTKQYRGNEG
QMRELQDQLEAEQYFSTLYKTQVKELKEDIEERNRQVQEAHKKVQELHSERDSLLAQLDL
TVTKAESEQLARALQEEQYFELSQENKKATARHKQEGTEKDATIARLEDSNKTLTKDVEN
LSKEKAELNNKLXIQEEEYASQKEEITNTIKANYEKVLSTERTLKTQAVNKLAEIMNRKD
MKLDTKKKGNTTDLRKKEKENRKLQLDLKQEKDKFNHMAIKNQKELSEMQAQLSEECTYR
NELQMQLDSKESDIEQLREKLNDLQLRMDNSSVTSLQMDETDSNIAESRLEGWLSIPNKP
NIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEE
IPRIFQILYANEGECRKEADMETVSQGDKTNCLPHKGHEFIPTLYHFPTNCEACAKPLWN
VFKPPPALECRRCHVKCHQDHLDKKEDVIAPCKVNYDVTSARHMLXLALTQDEQKKWIGH
LGKKIPKTPPSSFLRASPRTMSTRPAPNQSFRKNPKSITGKPSRLQSHSATTASSLQAAD
TTSSTC
NT seq 4161 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctggagaaagtttggaagctcgttttgagaaaatcgatgccatgttgaaggac
ccgaagtcggaaataaacactgattgccttttggatggcttggatgcgttggtgtacgac
cttgactttccagccttgaggaaaaacaaaagcatcgacaactttttgaatagatataag
gacaccatcagtaagatccgggacctgcggatgaaagcagaggactatgaggtggtcaag
gttatcgggaggggtgcttttggagaagtgcagttggtaagacacaaagccacgaggaag
gtgtacgccatgaagctgcttagcaagtttgaaatgatcaaaaggtcggactctgctttc
ttctgggaggagagggacatcatggcctttgccaacagcgcctgggttgtgcagctgttt
tatgcgttccaggatgaccgtaacctctacatggtgatggagtatatgcccggcggagac
ctggtcaacttgatgagcaactatgatgtccccgagaagtgggcccgcttctacaccgct
gaggtggtgctggctctagacgggatccacgccatgggcttcatacacagggacgtgaag
cctgataacatgttgctagataaagcgggccacttgaagttggcagactttgggacctgt
atgaaaatgaacaaggatggtatggtacgatgcgacacagcagtgggaacaccagactac
atttcgccagaggtactaaaatcccagggaggagatggatattacggccgggagtgtgac
tggtggtccgtgggagtcttcctgtatgaaatgcttgttggtgacacaccgttctatgct
gactcgttggtggggacgtacagtaaaatcatgaaccacaagaacgccctgaccttccct
gatgacagcgacatctccaaggatgccaaaaaccttatctgtgccttcctgactgacagg
gaggtaagactgggtcgcaacggggtggatgagatcaagagacatcctttcttcaagaac
gaccagtggacatgggagaacatccgygatacggcggccccggtggtgcctgagctgagc
agcgacatcgacaccagraactttgacgagatcgaggcggaccggggagacgaggagacc
ttccccataccaaaggccttcgtgggcaaccagctgccctttgtgggcttcacctactat
agcagtcatcagttttcccggagctccygcaccaagagtgttgacaaacgcagcagctcc
actaaggaagacaagagccatctggagaacctgcagaagaggatctaccagctagaagaa
caactccacagtgagatgcagctgaaggacgaaatggagcagaagtgcaggacctcgaac
acaaagcttgacaagatcatgaaagagctggacgaggagggcaacgtgaggaagggtgta
gaggccagcatgtccctgctggagaaagacaagatgatgacccagcaccgagccaccgag
taccaaagaaaggccgaccaggaggccgagaagagacgcaacttggagaacgaggtgtcc
actctgaaggagcagcttgaggacatgaggaaaatctgccaaaactctcaggcctcgaat
gacaagatcctacagttgcaaaatcagctggaggaggccaatgacctgctgcgggcagag
tcggacacggcagcgcggctgaggaagagccacacagagatggccaagtccatgagccag
ctggaggggctgaaccgcgagctgcaggagaagagccgttcgtctgacggggggagggcc
cagctagagaaggagctgrtgcagctgcagagcaccctggactctgaaaggaggtgctac
agccagggatcagaggagatccacgagctgcaagtgcggatgactggttttcaggaggac
aataagaacttggaactcagcctgtccaaagtggaggcggaacgcaagcaggcccaggag
kggagaaacaacctggagaaggagaagaacaacctggagattgacctgaactacaagctg
aagactctgcagcaycgtttggaccaggaacacacagaacacagagtgacacgggcccag
ctcactgacaaatacgagtccattgaagaggccaagtcagctgccatgcatgcggtgcag
cagaaggtgtcggaggagagcggggcgaggatgcgagcggagagcagggtggtggaggtg
gagaagcagtgctccatgctggagtttgacctcaagcagtccgtgcagaagatggagcag
ctgatgaagcagaaggagaggctggaggacgaggtgaaaggtctacggatgcagctggag
caggagtccagtaaaaggctgctggcccagaacgagctgaagtgccgctcgcaggaggcc
gaccggcttaagagctcggagaagcagctgaagcaggagatcaacacggcactagagagc
aaacggtcgctcgagttccagctcgcacagctcactaagcagtacaggggcaacgaggga
cagatgagggaacttcaggaccagcttgaggccgaacagtatttttcaacgctttataaa
actcaggtgaaggaactgaaagaggatattgaggagaggaaccggcaggtccaggaagct
cacaagaaggtgcaggagctgcacagcgaaagggactccctgttggcccagctggatctg
acagtgaccaaggcggagtcggagcagctggccagggcgctccaggaggagcaatacttt
gagctgagccaggagaacaagaaggccacggccagacacaagcaggagggcaccgagaag
gatgccaccatcgcacggcttgaggattccaacaaaaccctgaccaaagatgtggagaac
ctcagcaaggagaaggccgagctgaacaataagcttsgcattcaggaggaagagtatgcc
tcccagaaagaggagattacaaacacaatcaaggccaactacgagaaggttctcagcaca
gagcgcacgctcaagactcaggcggtgaacaagctggcagagatcatgaacaggaaggat
atgaagctggacaccaagaagaagggcaacacgaccgacctgaggaagaaggagaaggag
aaccgcaagctgcagcttgayctcaaacaggagaaggacaagttcaaccacatggccatt
aagaaccagaaggagctcagtgagatgcaggcgcaactgtccgaggagtgcacgtaccgc
aatgagctmcagatgcagctggacagcaaggagagtgacatcgagcagctgagggagaag
ctcaacgacctgcagctgcgcatggacaactccagcgtcaccagcctgcagatggacgag
acggacagcaacatcgccgaatccagactggaagggtggctgtccattcctaataaacct
aatatcaaacgatatggctggaagaagcagtatgtggtggtgagcagcaagaagattctg
ttctacaacgatgaacaggacaaagaacagtccaacccctccatggtactagatatcgac
aaactgttccacgtgcgtccagtcacccagggtgatgtgtaccgagcagagaccgaggag
atccccaggatattccagatcctgtatgccaatgagggggagtgcaggaaggaggcggac
atggagacggtctcgcagggcgacaagaccaactgtctgccccacaaaggtcatgagttc
atccccacgctttaccacttccccacaaactgtgaggcctgtgccaagcccctgtggaat
gtcttcaagcccccacctgccctggagtgccgccgctgccacgtcaagtgccaccaggac
cacctcgacaagaaggaggacgtcattgcaccctgcaaagtgaactacgacgtgacctct
gcccggcacatgctcrtgctagccctgacccaagacgagcagaagaaatggatcggccac
ctgggcaagaagatccccaaaacaccgccctcctccttcctgagggcgtcgccccgcacc
atgtccacgcgccccgcacccaaccagtccttccgcaagaaccccaaaagcatcacaggg
aagccaagcaggttgcagtctcattctgctaccacagcctccagcctccaagcagcagac
acaacatccagcacttgttga

DBGET integrated database retrieval system