KEGG   Salvelinus alpinus (Arctic char): 111979478Help
Entry
111979478         CDS       T05762                                 

Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2-like isoform X1
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00760  Nicotinate and nicotinamide metabolism
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    111979478
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     111979478
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     111979478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 111979478
NCBI-ProteinID: XP_023865823
AA seq 312 aa AA seqDB search
MTDNTKTHVILLSCGSFNPITKGHIHMFEKAREYLHKTGKFIVIGGIISPVHDSYGKPGL
VPSRHRLTMCQLAVQSSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTP
STTPVIGQPQNETQTAIYQNHNTMNNKPSASEGSFKLWGKMSESLGKICCVRPHIDRFTF
VDENANLGTAMRYEEIELRILLLCGSDLLESFCIPGLWKDSDMEVIVGDFGIVVVPRDGV
DTERIMNHSSVLRKNKDNITVVKDDANHPMSIVSSTKSRLALQHGDGHVVDYLNQTVIDY
ILQSQLYINASG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacggacaacactaaaacgcacgttattttgctgtcatgtggaagttttaaccccatc
actaaaggacacattcatatgtttgaaaaagccagagaatacctgcacaaaacagggaag
ttcattgtgattgggggtatcatttcacctgtacatgactcctatggcaaaccgggcctc
gtccccagcagacatcgtctcaccatgtgtcaactggcagtccagtcttccgactggatc
agagtggatccctgggagtgctaccaggacacatggcagactacatgcagcgtgctggag
catcatcgtgacctcatgaagagagtcacagggtgcattctgtccaatgtgaacacaccg
tccacaactccagtgatcggccaaccacagaatgagactcagactgccatctatcagaac
cacaacacaatgaacaacaagccctctgccagtgagggatcatttaagctttgggggaag
atgagcgagagcttgggcaaaatttgctgtgttcgcccccacattgatcgttttaccttt
gtggatgaaaatgccaaccttggtactgcaatgcgatatgaggaaattgagttgcgcatc
ttgcttctgtgtggcagtgatcttctggagtcattctgcatccctggcttatggaaagac
agtgatatggaggtgattgtgggagactttgggattgttgttgtgcctcgggatggagtt
gatacagagaggataatgaaccattcctctgtgctgcgcaagaacaaggataacatcaca
gtagtaaaagacgatgccaaccaccctatgtccattgtcagctcaaccaagagcagactg
gccctgcagcacggggacggccatgtggtggactacctgaaccagacagtcatcgactac
atcctgcagagtcagctctacatcaatgcctctggatag

DBGET integrated database retrieval system