KEGG   Salvelinus alpinus (Arctic char): 111979620
Entry
111979620         CDS       T05762                                 

Definition
(RefSeq) uncharacterized protein LOC111979620
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:salp03000]
    111979620
Transcription factors [BR:salp03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    111979620
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 111979620
NCBI-ProteinID: XP_023865983
AA seq 630 aa
MIPPGDCLYAGRKRRKPIQKQKQTAATQKTNPSKRHRDRLNTELDRLASLLPFTPDIISK
LDKLSVLRLSVSYLRVKSFFQAIQEKPCRKHIMKPPLNHQDTRKESLPIGTPRTSISVVE
SDLLLESLTGLALVVSTDGLIFYVSTSIVDYLGFHQTDVMHQNVFDYVHVEERQEFRRQL
HWAMNPGPQGASLNQHSATVTDDDFVMSSLFNALEPDGVPLELTSFLTRCFIARVRCLLD
STSGFLSMQFQGSLKFLQGQKKKTESGALLPPQLALFCVAVPLMIPSITELKMKNMTARS
KNKGPVITTPDKHSSTTREPCHYTPWTPLSKDGTRYKNDSYCTQEEPLNFCLSSMSGGPK
AQSMDHPWDIRTGSAMRKGPSGTYTPGRQSKYNHLGKTRSYRMSPGYHANRQDASQNKLY
GGLHSPEVESYCEDGMKTDNRYMGNHLDCYNGMVLPETVIKTEQDSDSENGCNIYGMTQN
RAWVGNEKRYMGYSEEPQVKSEADYYEQYTTCQKNKTNMSPTLNGHHKYLYTAGNRAQKD
HRIPDSDTLCSSQGENCTDISVYGYMQQDNKLNYEFRNHLVHAIKREPMDSPPWSDNGHD
ISQIPMQRSMIPNSSMNAIVYKPNPYIYMQ
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgattccacctggggactgcttatatgcgggaaggaagagaaggaagcccatccaaaaa
caaaaacagacagcggccacccagaagaccaatccatctaagaggcaccgtgaccgtttg
aatacagagctggaccggctggccagtctcctacccttcaccccggacatcatctccaaa
ctggacaagctctccgtgctgcgcctcagtgtcagctacctccgggtcaagagcttcttc
caagccatccaggagaagccatgcagaaagcacatcatgaagccgcctttgaaccaccag
gataccaggaaagagagcctgcccattggaaccccgaggaccagcatcagcgtggtagag
agtgacctcttactggagtccttgactggtttagccttggtggtgagcacagatgggttg
atattctacgtctccacctccattgttgactacctgggctttcatcagacggatgtgatg
caccagaatgtatttgattatgtacatgtggaggagcggcaggagttcagaagacagctc
cactgggccatgaaccccgggccccagggggcatccctgaaccagcactcggccacagta
actgatgatgattttgtgatgagcagtctctttaacgccctggagcctgacggtgttcct
ctagagctcacctctttcctgactcgctgtttcatcgcccgggtccgctgcctattggac
agcacctcaggctttctgagcatgcagttccagggcagcctgaagttcctgcagggccag
aagaagaagacagagtccggggcactgctgcccccccagctggccctgttctgtgtggcc
gtgccactcatgataccctccatcacagagctgaagatgaagaacatgacggccaggagc
aagaacaagggccccgtcatcaccacaccggataagcacagcagcactaccagagaaccc
tgccactacaccccatggacacccctctccaaagacggcaccaggtacaagaacgacagc
tactgcacccaggaggagcccctgaacttctgcctatcctccatgagtggtggtcccaaa
gctcagagcatggatcatccatgggacattcgcacagggtccgccatgcgaaagggccca
agcggcacctacacaccaggcagacaaagcaagtacaatcacctggggaagactagatcc
tacaggatgtctccaggatatcacgctaacagacaggacgcatctcagaacaagctgtac
ggaggcctccacagccctgaggtggagagctactgcgaagatggcatgaagacagacaac
aggtacatgggcaaccatcttgactgttacaatggcatggtgttgcctgagacggtcata
aaaacagagcaggactctgactcagaaaacggttgcaatatctacggcatgacccaaaat
agagcctgggtggggaacgaaaagcgctacatgggctactcagaagaaccacaggtgaag
tcagaggctgactactatgaacaatacaccacctgccaaaagaacaagaccaacatgagc
ccaacgctcaatggacaccataaatacttatatacagcggggaacagggctcagaaggat
cataggataccagactcagacactctgtgtagcagtcagggagaaaactgtacggacatc
agtgtatatggctacatgcagcaagacaacaaactgaactacgagttcaggaatcacctg
gtccacgctataaagagggaacccatggactcacctccatggtctgacaatggccatgac
attagccaaatacccatgcagagaagtatgattcccaactcatcaatgaatgctattgta
tacaaaccaaacccatatatctacatgcaatga

DBGET integrated database retrieval system