KEGG   Salvelinus alpinus (Arctic char): 111981905Help
Entry
111981905         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: dedicator of cytokinesis protein 7-like
Organism
salp  Salvelinus alpinus (Arctic char)
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 111981905
NCBI-ProteinID: XP_023869164
AA seq 2110 aa AA seqDB search
MASSTNERRAFAHKINRTVAAEVRKQVSREYGSPQLSKKRGAHQPVPLTEVVEPVDYEEY
VSSHAPGAEPCPLRQLMEFPPDDLELLLQDRECTTLEPPLPEEDTFDPRVRDALGVYTDD
WLIIQRKYQRYSTTHTPHNSERQRERQRGLVKQTFELDEAAATDRQDDQDDAKRRSVSLD
DTPRGSWASSIFDLKNSSPDALLPSVLERTAAEDMDRRNAEARLQGRHSDLLGLFPPPDE
DEAVERCSVPEVPKEHCGQRIMVKCLSLKFEIEIEPIFGTLALYDVKEKKKISEDFHFDL
NSDQMKGLLRLHTPHTAISTLARSAIFSITYPSADIFLVIKLEKVLQQGDIGESCEPYMV
MKESDSSKHKEKLEKLRLQAETSCSRLGRYRMPFAWTAIHLVNIVSSVGGLERSDPDSDS
GKRKGHGTWNERKKKGFERMSVGEDMCNFATFRPATLTVTNFFKQEGDRLSDEDLYKFLA
DMRRPSSVLRRLRPVTAQLKIDISPAPDSPHYCLSPELLHVKPYPDPRVRPTKEVLEFPA
RYVYTPHTTYRNLLYIYPQSLNFSSRQGSVRNIAVKVQFMAGEDPSLAMPVIFGKSSCAE
FFTEAYSPVIYHDKSPEFYEEVKMKIPANLTDNHHLLFTFYHISCQPKQNTPLETPVGYT
WIPLMQHGRLRAGSFSLPVSVEKPPPSYSVLTPDVQLPGMKWVDNHKQVFNVEVTAASSV
HTQDPHLDKFFTLCYVLEEYSFPFRLKDCIISEANVEGELKASMTGLRGALLDTCVRFLH
QLLSKLILLIVHPPVIAGQIVNLGRAAFEAMSLLVNQIHKNLEGNQDQHGRNNLLASYIH
YCFHLPTAEPAMPPTGGATPAYELPIQYATLSRATARPSTLHLARSKSISNSNPDLASTP
TSPDEEVQRIIGSKGIDRSHSWVNSAYAPGGSRAVLRRNPNFTCELKQASDRGCNRMSAF
VDSATFCSAPTRQIAKKLLHEELALQWVVSTSTVREAALQQAWFFFQLMTKSMSHHLFLS
SRIDLPRRQRFPDRFVDDIAALVGAISADVAGRYHKDVELVERLNSSLAFFLNDLLSLMD
RGFVFNLIRSYYKQIANKFHTAQNPSSLTALRMDFTRIVCSHEHYVTLNLPCSTLSPPAS
PSPSTSSTTSQGSAFSSMHQDQGVASMFELSVPFRQQHFLSGLLLTELSLILEPDAEGVF
FLHKKAISAVHSLMCSHDADPRYTDPQVRTHIAQLYLPLIPIVMDTLPQLHDFTDTSPAR
GRHAPAMQEDGEPDNGTISQSVAMAIAGSPLPHAKAPNFTMPTVAGRQCSSLSAECSRTL
LVSFLWVLKNADAALLESWVSDLSVLQINRLLDLLHLSVSCFEYKGKKALERINSLTFKK
SQDMKARLEEAILGTIGARQEMVRRCRERSPYGNENVRWRKNVTHWRQNTDRVDKTKAET
EQESVVDGNLATEASLVVLDTLEIIVKTVLASELKESVLGGVLRVLLHSMAGSQSALFLQ
HCFTTQRGLVFKFPEMLFEEDTELCADLCLRLLRHCSSSVGSVRSQASASLXLLMRQNFE
IGNNFARVKMQVTMSLSSLVGTSQNFNEEHLRRSLKTILTYAEEDLELRDSPFPEQVQDL
VFNLHMILTDTVKMKEHQQDPEMLIDLMYRIAKGYQNSPDLRLTWLQNMAGKHSERGNHA
EAAHCLVHSAALVAEYLNMLEDCRYLPIGCVTFQHISSNVLEESAVSDDILSPEEEGICA
GKYFSELGLVGLLEQAATSFHMASMYEAINEVYKILLPVHEANRDFKKLAIVHGKLQDAF
NKIYNQSSGWERMFGTYFRVGFYGCRFGDLDEQEFVYKEPSITKLAEISYRLEEFYAERF
GDDVVEIIKDSNHVDKNKLDPNKAYLQITYVEPFFDTYELKERITYFDKNYNLRTFMYCT
PFTLDGRAHGDLHEQYKRKSILTTSHAFPYIKTRVNVIHKEEIILVPMEVAIEDMQKKTQ
ELAFATHQEPADAKMLQMVLQGSVGTTVNQGPLEVAQVFLSDIPXDPKLYRHTHKLRLCF
KDFIRRCEDALRKNKTLIGPDQKEYHKEMERNYNKLKESLGPSSPASIPQLLQDTAGCRA
SVCYTKKFLQ
NT seq 6333 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttcaaccaacgagaggagggcatttgctcacaaaattaatcggacggtggct
gcagaggtcaggaagcaggtatccagagagtacggctcccctcagctgtccaagaaacga
ggagcacaccagcctgtgccactgacagaggtggtggagcctgtggactatgaggagtat
gtgagtagccacgcccctggggcggagccttgccccctcagacagctgatggagttcccc
ccagatgacctggagctcctcctgcaggacagagagtgtactacactggagccccctctg
cccgaggaggacacatttgacccaagagtgagagatgccttgggtgtctacacagatgac
tggttgatcattcagaggaagtatcagcgttacagtacaacccacaccccccacaactct
gagcgccagagggagaggcagcgagggctggttaagcagacctttgaactggacgaggct
gcggccactgaccgccaggatgaccaggacgatgctaagcggcggtcagtctctctggat
gacacaccccggggtagctgggcctccagtatttttgacctgaagaactcgtcgccggac
gccctgctgccctcggtgctagagcgcacggctgcagaggacatggaccgccgcaacgct
gaggcccgcctgcaggggcgccactctgacctgctggggctcttccctcctcccgacgag
gatgaggctgtggagagatgttctgtcccagaggtccccaaagaacactgtggtcagagg
atcatggtcaagtgtctgtccctcaaatttgaaatagaaattgagccaatatttgggact
cttgctctctatgatgtcaaggaaaagaaaaagatctcagaggacttccactttgacctg
aactcagatcagatgaagggtttgcttcgtctccacacgccccacacagccatctccacc
ctggcccgctcagccatcttctccatcacgtacccctctgcagacatcttcctggtcatc
aagctggagaaagtccttcagcagggagacataggggaatcctgtgaaccctacatggtc
atgaaagagtcggactcatcaaagcacaaggagaagctggagaagctgcgtctgcaggcg
gagacgtcgtgtagcaggctggggaggtacaggatgccctttgcctggacagccatccac
ctggtcaacatcgtcagcagtgtgggcgggctggagcgctctgaccctgactctgactct
ggtaagcggaaaggccatggaacatggaacgagagaaagaagaaagggtttgagcggatg
agtgtaggagaggacatgtgcaactttgccaccttccgtccagccactctcacagtcacc
aacttcttcaaacaggagggggaccggctgagtgatgaagacctctacaagtttctggca
gacatgcgcagaccatcctctgtcctacgcagactgagacctgtcacagcccagttgaag
atagacatctctcctgccccagactctcctcactactgcctgtctcctgagctgcttcat
gtcaagccctaccctgacccgagggtgcgccccaccaaggaggtgctggagttccctgca
cgctacgtctacacccctcacaccacctacaggaacctgctgtatatctacccccagagc
ctgaacttcagcagtcggcagggctcagtcaggaacattgctgtcaaggtgcagttcatg
gcaggagaggatcccagtctggccatgccggtgatctttgggaaatccagctgtgctgag
ttctttacagaggcttattcacccgtcatctaccatgacaagtctccagagttctatgag
gaggtgaagatgaagattccagccaacctgacagacaaccaccacctcctgttcaccttc
taccacatcagctgtcagcccaaacagaacacgcccctggagaccccrgtgggatacacc
tggattcctctgatgcaacatggccgcctacgggccggttccttcagtctgccggtctct
gtggagaaaccaccacccagctactccgtcctcacccctgacgtgcagcttccaggcatg
aagtgggtggataatcacaagcaggtgttcaatgtggaggtgacagctgcctcctcagtt
cacactcaggacccccacctggataagttcttcaccctgtgttacgtcctggaggagtac
tcgttcccattccgtctgaaggactgtatcatcagtgaggccaacgtggagggtgagctg
aaggccagcatgaccggcctgcggggggcgctactcgacacctgcgtccgcttcctccac
cagctgctctccaaactcatcctgctcatcgtccacccgcccgtcatcgcaggacagatc
gtgaacctgggccgtgcagcgttcgaggccatgtccctgctggtcaaccagatccataag
aacctggaggggaaccaggaccagcatggcaggaacaatctgctggcctcctacatccac
tactgcttccacctgcccactgccgagcctgccatgccccctactgggggtgccaccccg
gcctacgagctgcccatccagtacgccacgttgtccagggcaacggcccgccccagcacc
ctgcacctggcccgctccaagagcatcagtaactccaaccctgacctggccagcaccccc
acgtcacctgacgaggaggtgcagaggatcatcggcagcaaggggatagaccgctcccac
tcctgggtaaactctgcttatgcccccgggggctccagagctgtgctacgccggaacccc
aacttcacctgtgagctcaagcaggcaagtgatcgtggctgcaatcgcatgtctgccttt
gtggacagcgccaccttctgttcagctccaacaagacagattgccaagaagctgctccat
gaggagctggcactacagtgggtggtgagcaccagcacggtgagggaggcagcactgcaa
caggcctggttcttcttccaactcatgacgaagagtatgtcccaccacctgttcctgtcc
tcccggatagaccttcccagacgccagcgcttcccagaccgctttgtggatgacatcgct
gctctagtgggggctatcagtgctgatgtagcagggcgataccacaaggatgtggagctt
gtggagaggttgaacagcagtctggccttcttcctgaatgacctgctgtctctcatggac
cgtggctttgtcttcaacctcatccgctcctactacaaacagatcgccaacaagttccac
acagcccagaaccccagctctctgactgctctgagaatggacttcacccgcatcgtgtgc
agccatgaacactatgtcaccctcaacctaccctgctccaccctcagcccccccgcctcg
ccctccccctccacctcctccaccacctcccagggttcagcgttctccagtatgcaccag
gaccagggtgtggccagtatgtttgagctctccgtccccttcagacagcaacacttcctg
tctggcctgctgctgactgaactatccctcatcctggagcctgatgcggagggggtgttt
ttcctgcataaaaaggccatcagtgcagtccactctctgatgtgcagtcatgatgcggac
cctcgctacacggacccccaggtgcgaacccacatcgcccagctctacctgcccctcatc
cccatcgtcatggacaccctgccccagctccatgacttcacagacacttctcccgcccgg
ggccgccacgcccccgctatgcaagaggacggggaaccagacaacggaaccatcagtcag
tctgtcgccatggcgatcgctggctccccgctgccgcatgccaaagcccccaacttcacc
atgcccacggtggctggtcgtcagtgcagctctctgtcggcagagtgcagtaggactctg
ctggtgtctttcctgtgggttctgaagaacgcagacgctgctctgctggagagctgggtg
tcagacctctctgtgctgcagatcaacaggctgctagacctgctgcacctctcggtgtcc
tgcttcgagtacaaggggaagaaggctctggagcgtatcaacagcctgacgtttaagaag
tctcaggacatgaaggctcgtctagaggaggccatactgggaaccatcggagcccgacag
gagatggtccgtcgctgcagagagcggagtccatatggcaatgagaatgtcagatggagg
aagaacgtcacmcactggagacagaacacagacagagtcgacaaaaccaaggcggagacg
gagcaggagtccgtggtggatggaaacctggccactgaagcctctctggtcgtcctggac
acgctggagatcatagtgaagacggtgctggcgtcggagctgaaggagagtgttttgggc
ggagtgttgagagtcctcctccacagcatggcagggagtcagagtgccctcttcctgcag
cactgcttcactacacagaggggactggtctttaagttcccagagatgctgtttgaggag
gacacagagctgtgtgctgacctgtgtctgcgtctgctccgccactgcagcagcagtgtg
ggctctgtccggagtcaagcctccgcctccctctarctgctgatgaggcagaactttgag
atcggcaacaactttgcccgggtgaagatgcaggtcaccatgtccctgtcctccctggtg
gggacatctcagaacttcaacgaggagcacctccgacgttccctaaaaaccatcctgacc
tacgcagaggaggacctggagctacgggactccccgttcccagaacaggtccaggatctg
gtcttcaatctgcacatgattctgactgacacagtcaagatgaaggagcaccagcaggac
cctgagatgctcattgatctcatgtacaggattgctaagggctatcaaaactcccctgac
ctgcgtctgacgtggctgcagaacatggcggggaagcactcggagagagggaaccacgcg
gaggcagcccactgcctggtgcacagcgccgccctggtggcagagtacctcaacatgctg
gaggactgccgctacctgcccattggctgtgtcaccttccagcacatctcgtctaatgtt
ctggaggagtcagcggtgtctgatgacatcttgtccccggaggaggagggtatctgtgca
gggaagtacttcagcgagttggggctggtggggctgctggagcaagctgcaacctccttc
cacatggcttccatgtacgaggccatcaacgaggtgtataagatcctactcccggtccac
gaggccaacagagacttcaagaagctggctattgtccatggaaagttgcaggacgccttt
aacaaaatctacaaccagagttctggatgggagaggatgtttgggacctacttccgggtg
ggcttctacggctgtcgctttggggacctggatgagcaggagtttgtgtacaaggagccc
tctatcaccaagctggctgagatctcctacagactagaggagttctatgctgagcggttt
ggagatgatgtggtggagattatcaaggactccaaccatgtggacaagaacaagctggac
cccaataaggcctacctccagatcacctacgtggagcccttcttcgacacgtacgagctg
aaggagaggatcacctacttcgacaagaactacaacctgcgcacrttcatgtactgcacc
cccttcaccctggacgggcgcgcccacggggacctgcacgagcagtacaaacgcaagtcc
atcctcaccacgtcccacgctttcccctacatcaagacacgcgtcaacgtcatccacaaa
gaggagatcatcctggtgcccatggaggtggctatagaggacatgcagaagaagacccag
gagctggccttcgctacccaccaggagcctgccgacgccaagatgctgcagatggtgctg
cagggctccgtgggcaccactgtcaaccagggccctctggaggtggcccaggtctttctc
tctgacattccgnatgaccccaagctgtaccgtcatacacacaaactacgcctctgcttt
aaagacttcataagaaggtgtgaggatgccctgaggaaaaacaagactctgattggtcca
gaccagaaagagtaccacaaggaaatggagaggaactacaataagctgaaagagtctctg
ggaccctcatcacccgcaagcatcccacagcttctacaggacactgccggctgcagggct
tcagtctgctacacaaagaaattccttcagtag

DBGET integrated database retrieval system