KEGG   Salvelinus alpinus (Arctic char): 111982655Help
Entry
111982655         CDS       T05762                                 

Gene name
atg16l1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04136  Autophagy - other
salp04140  Autophagy - animal
salp04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:salp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111982655 (atg16l1)
   04136 Autophagy - other
    111982655 (atg16l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111982655 (atg16l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:salp04131]
    111982655 (atg16l1)
   03029 Mitochondrial biogenesis [BR:salp03029]
    111982655 (atg16l1)
Membrane trafficking [BR:salp04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    111982655 (atg16l1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    111982655 (atg16l1)
Mitochondrial biogenesis [BR:salp03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    111982655 (atg16l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Nup160 ADIP DUF4200 DUF1664 DUF812 Lipoprotein_6 TMP_2 KASH_CCD
Motif
Other DBs
NCBI-GeneID: 111982655
NCBI-ProteinID: XP_023870032
AA seq 621 aa AA seqDB search
MAERRVECSWKRHVGEQLKQRDRVQRQAFEEIIHQYNRLLEKSDLQAVLSERYQSDKYDF
QNRHDGSPGADSSRSDNLQQEMAQMRIRHQEELTELHKKRGELAQSVIELNHQIQQKDKE
IQRNEAKMQEYQRQIAELEGECRELRGQLQDLEQANQTLKDEYDALQITFGALEEKLRRT
TDDNQELVSRWMAEKSQEANKLNAENEKDCKRRQAKLQKELADAAKEPLPMDPDDDIEVL
ADDSVKGTREASPNRPLSRTPSKRISGQSPQSGLLDSISNIFGVSESVHPGLLPPDSRRR
TGNSYGTSLENTETTSGVCADVRVPSTALHVFEAHDGEVNAVRFSPGSRLLATGGMDRRV
KLWEVVSGRCEPKGALTGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTG
HSGKVLAARFLLDNARIVSGSYDRTLKLWDLRSKVCMKTVFAGSSCNDIVCTEQCVMSGH
FDKKVRFWDIRAESIVCELELLGRVTSLDLNHDRTELLTCSRDDLVKIIDLRSNAIRQTF
SAQGFKCGADWTRVTFSPDGSYVAGGSADGALYVWNVLTGKLERTLDKNHCSAINSVSWS
PSGAYVVSVEKGSKAVLWSDM
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacgtcgtgtggagtgttcatggaagaggcacgtcggtgagcagctgaagcag
agggaccgtgtgcagaggcaggccttcgaggagatcatccaccaatataaccgtctcttg
gagaagtccgatctacaggctgttctttcagagagataccagtcggacaaatatgacttt
cagaacagacatgacggcagcccgggggcggactcgagtcgcagcgacaacctacagcag
gagatggcccagatgcgaatcaggcaccaggaggagctgacagagcttcataagaaacgg
ggcgagctggcccagagtgtgattgagctgaaccaccagattcagcagaaggacaaggag
attcagcgcaatgaggccaagatgcaggagtaccagcggcagattgccgagctggaggga
gagtgccgggagctgcgtggtcagctgcaggacctggagcaggccaaccagacgctgaag
gatgagtatgacgccctgcagatcaccttcggtgccctggaggagaagctgcggcgcacc
accgacgataaccaggagttggtgtcgcgctggatggccgagaaatcccaagaggccaac
aagctcaatgcggaaaacgagaaagactgcaagcgcagacaagccaagcttcagaaggag
cttgcagacgctgcaaaggagcccctgcccatggacccggacgacgacatcgaggttcta
gctgatgattctgtgaaaggcactagagaggcctctcccaaccggccgctcagccgcacc
cccagtaaacgtatctccggacagtctcctcaaagcggcctgttggactcaatctccaac
atatttggcgtatctgagtctgtgcatcccggactccttcctccagactccaggcgtcgt
actgggaactcgtacggaacatcactcgaaaacacggagacgacctccggagtgtgtgcc
gatgtccgcgttccctccactgccctccatgtatttgaagcccatgatggggaagtgaat
gcggtgcggttcagcccaggctcccgactcctggccaccggagggatggaccgcagggtc
aaactgtgggaggtggtctcaggtcgctgtgagccgaagggtgctctgactggtagcaac
gccgggatcaccagtatagagtttgacagtgctggctcctacttgctggctgcrtccaat
gactttgccagtaggatctggactgtggatgactatagactgaggcacacgctgacaggc
cacagcgggaaggtcctggcggctcgctttctcctggacaacgctcgtatagtctccggg
agctacgacaggactctaaaactgtgggacctgcgcagcaaagtctgcatgaagactgtg
tttgctgggtccagctgtaatgacatagtctgcacagagcagtgtgtcatgagcggccat
tttgataagaaggtgcggttctgggacatcagagcggagagtatagtctgtgagctggag
ctcctgggccgagtcacatcgcttgacctgaaccacgaccgcaccgagctgctcacctgc
tcccgggacgacctggttaagatcatcgacctgcgcagtaacgcgatccgccagaccttc
agtgctcagggcttcaagtgtggcgctgactggacccgagtcaccttcagtcctgatgga
agttacgtggcggggggctctgcagacggcgccttgtatgtgtggaacgtcctgacgggc
aagttggagcgcaccctggacaagaaccactgctcggccatcaactcggtgtcctggtcg
ccatcgggagcctacgtggtcagtgtggagaagggcagcaaggccgtcctctggtctgat
atgtga

DBGET integrated database retrieval system