KEGG   Salvelinus alpinus (Arctic char): 112068632
Entry
112068632         CDS       T05762                                 

Definition
(RefSeq) uncharacterized protein LOC112068632
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:salp03000]
    112068632
Transcription factors [BR:salp03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112068632
SSDB
Motif
Pfam: PAS PAS_3
Other DBs
NCBI-GeneID: 112068632
NCBI-ProteinID: XP_023991580
Position
Unknown
AA seq 572 aa
MGNSVTESGLLLESLTGFALVVSSDGMVFFSSSNIVDYLGFHQTDVMHQNVFDYVHVDDR
QEFRRQLHWAMNPSQHHLVSGTGEDFVVSSLFHSQETGGVVPEFSSFLNRCFMSRVRCLL
DSTSGFLTMQIQGRLKFLQGQKKKWGSGALLPPQLALFCVAVPLLLPSITEMKMNNMMMR
GRHKSGGGIITALEYGEREEQLRRQAGSAGGMVDGGDPLLLNCTKLGGPQQRRHAPWTPL
SKDSLKYKTEGGYSGQDEPLNYCKTSMGGAPHHKGPGLDSLWPMRPASGPIRGGQGGGYT
PSNRLGKGGHYGKPYRMSPSMCHGGGRGGEIYVPRMYESLESSGELDLYCVGEAVKSECY
GNXLLPEMPIKVEQDSDSEKGCDAYGRPWPCREPLDHRYHNGNSYVDNNGLHMKSEAEYY
EQYSPCQRGKAGISPISPPYNNGPFQNYNNMGGGRPLKSVVNKDQSQFSPQRLSHSDPLC
SSQSINCIDVYASGPMEHNNKGYMQQQDKLDYEFKGHGPRQTIKQEPVDSPQWSDGSGHD
MSHAVGHSQRNVMPHRVMNAGQHKANPCVYMQ
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgggcaacagcgtcacggagagcggactccttctggagtcccttactggctttgcgttg
gtggtgagcagcgatggaatggttttcttttcctcctcaaacatcgttgactatttgggc
ttccatcagacggacgtgatgcaccaaaacgtctttgattatgtccatgtagacgaccgg
caagagttcagaagacagctccactgggccatgaaccccagccagcaccacttagtctca
ggaactggtgaggactttgtggtgagcagcctgtttcattctcaggagacggggggagtc
gttcctgagttctcctcttttctcaaccgctgtttcatgtcccgcgtgcgctgcctgctg
gacagcacctctggcttcctgaccatgcagatccagggccgactcaagttcctccaagga
cagaagaagaagtggggctcgggggccctgctacccccccagctggccctgttctgtgtg
gccgtgccccttctgctgccctccatcactgagatgaagatgaacaacatgatgatgagg
ggcaggcacaagagtggagggggcatcatcactgcactggaatatggtgagagagaggag
cagttgaggaggcaggctggcagtgcgggggggatggtcgatggcggggacccgctgctc
ctcaactgcaccaaacttgggggtccccagcagcgccgccacgccccctggacgcccctc
tccaaagacagcctcaagtacaagacagaggggggctattctggacaggacgagcccctc
aactactgtaagacctccatgggcggtgccccccaccacaaaggcccaggcctggactcc
ctgtggcccatgcggcctgcctcggggcccatccggggggggcaaggtggcggctacacc
ccctctaatcgactcgggaagggtgggcactatggcaagccctaccgcatgtcccccagc
atgtgccacggaggagggcgaggtggtgaaatctacgtgcccaggatgtacgagagcctc
gagagctccggcgagttggacctgtactgcgtgggagaggcggtgaagagcgagtgctac
ggcaacrtcctgttgcctgagatgcccatcaaggtggagcaggactcggattcggagaar
ggctgcgacgcgtatggccgtccgtggccctgccgggagcccttggaccaccgctaccac
aatggcaacagctatgtcgacaacaacggcctccatatgaagtcggaggcggaatactac
gaacagtactcgccgtgccagaggggcaaggcgggcatcagccccatcagcccgccctac
aacaacggccccttccagaactataataacatggggggcggcaggcccttgaagagtgtg
gtcaataaggaccagtcccagttcagtccccagaggttgtcccactcagaccccctctgt
agcagccaaagcatcaactgcatcgacgtgtacgcaagcggccccatggagcacaacaac
aagggctacatgcagcagcaggacaagttggactacgagtttaaaggtcacggaccgcgc
cagaccatcaagcaggagcccgtggactcaccccagtggtcggacggcagcggacacgac
atgagccatgccgtgggacactctcagaggaacgttatgccccaccgtgtgatgaatgct
gggcagcacaaagccaacccttgtgtttatatgcaatag

DBGET integrated database retrieval system