KEGG   Salvelinus alpinus (Arctic char): 112068763Help
Entry
112068763         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    112068763
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:salp04131]
    112068763
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:salp04812]
    112068763
   04147 Exosome [BR:salp04147]
    112068763
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112068763
Protein kinases [BR:salp01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   112068763
Membrane trafficking [BR:salp04131]
 Others
  Actin-binding proteins
   Others
    112068763
Cytoskeleton proteins [BR:salp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     112068763
Exosome [BR:salp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112068763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 fn3 ig Ig_2 V-set C2-set_2 Pur_ac_phosph_N Receptor_2B4 Izumo-Ig Ig_6 THB C1-set Egh16-like DUF5640
Motif
Other DBs
NCBI-GeneID: 112068763
NCBI-ProteinID: XP_023991730
Position
Unknown
AA seq 16717 aa AA seqDB search
MSTQAPTFTQPLQSGVALEGSAATFEAQVSGNPVPEVSWFRDGQVLSAAALPGAQISFSD
GRAVLMIPVVTAAHSGRFSVRATNGAGQATSTAELLVTAETAQPNFIQRLQSMTVRQGSQ
VRLDVRVAGIPTPVVKFYREGAEIQSSADFQIVQEGDLYSLLIAEAFPEDSGTYSVNASN
SSGRTTSTAELLVQGEEAVPAKKSKTVVSASSQTRVETRSMEAHFESSSSSMQMRVEGGV
VSHQAHMTPPRVPPKPTSTSKSPTPPSLAARVAGGRHQSPSPVRHVKVPTPAPFRLVSPS
SRLSVSPIRPVKSPLTTRKKVAHGPDVPPPWKQGDLVEGSSSYSSSMTSSATHAQASMSA
THVHMEQHWEGSYGSQTTGAAVSGVAVKEIRRSTETTIDHVDAAPAPSPIPHFTVSKVTV
PKPDPSYEIVETAAVPSHAEEPVMPPTLVAGLKNVTVTEGESVTLECQITGHPAPGIMWF
REDYRIESSIDFQITYESKCARLVIREAFVEDSGRFTCTATSEAGTISTSCYLLVQVTEE
IETREDMTQGLTQQETMTQQRTETMSEVNVTTAGSPVDTADAVAPFFVKKPTVQKLVEGG
RVVFECQIGGSPKPNIIWKKTGVPLTTGYRYKVHYNKESGVCKLEISMTFADDAGEYSIF
VKNPLGEESASASLLEEGEYEEYMKKHEMTYNTEVTTVQADVSPVVVSEYDEDQKYIQRM
AQMQSFVRTQEFQISSFEERIIHEIEIRILQITYQQIVTEDREEMVTVADREAVQSAFST
PVKNYRIMEGMGVTFHCKMAGTPLPKIVWYKDGKRIHHGGRYQMESLHDGRASLRLPVVL
PEDEGVYTAFASNMSGNSVSSGKLYVEPTAIAVAQRYTPEPQAMQRIRSQSPRSLSRSPG
RSTSRSPGRSTSRSPGRSTSRSPRRSPASRLDDTDESQLERLYKPVFVLKPQSFKCAEGQ
TARFDLKVVGRPMPDTFWFHNGQQVVNDYTHKIVVKEDGTQSLIVVPAMPHDSGEWTVVA
QNRAGKSSVSITLTVDAKENLVRPQFIEKLKNISVKKGTLVELAVKAIGNPLPDIVWLKN
SDIISPQKHPNIKIEGIKGQAKFYIPQSVSSDSAWYTATAINKAGRDTTRCRVNIEVDVA
APEPERRLIITKGTYKAKEIAAPELESLHLRYGQEQWEEADLYDKVKQQKPQFKKKLTSV
RLKHSGVVHFECRLTPIGDPTMVVEWLHDGKPLAAANRLRMVNEFGYCSLDFEVAYARDS
GVITCRATNKFGVDQTSATLIVKDEKSLVEEGRREIYRIDEMERMAHEGGPSGVTADEYS
EKSKPEIVLLPEPARVLEGDIARFRCRVIGYPTPKVNWYLNGQLIRKSKRMRLRYDGIYY
LEIIDIKLYDAGYVKVVAENPEGTAEHMVMIEITQKEDFRSILRRIPEPKAHDTTEHGRI
SFEVVKVDRPADAQPKEVVKLRKTERVIHEKSTEETDELKSKFKRRTEEGYYEAITAVEL
KSRRKDESYEDMLRKRKEDLLHHHKLLSEAKNKKDLEEGKLTIPTIKPEKVQLSPSMEAP
KILERIASQTVSQTEEVRFRVRVVGKPEPECQWFKNGILLEKTDRIYWFWPEDHVCELVV
RNVTAEDSASIMVKAMNIAGEASSQAFLLVQGKTVITFAQQLEDVEAKEKDTMVTFECET
SEPFIKVKWLKNNAEIFSGDKYRMHSDRKVHFLSVLIISMKDDAEYSCAVIEDDHIRTTA
RLNVEGASLSIVKRLENIEVPETYSGEFEVELSREDAEGTWYFNDKEITPSSKYVTSYRR
GRHTLSVKDIKKEDQGKYTFKIYDMHTSASLKMKLRPVTLMQPLTDLTICEGDIAQLEVR
FSQENVEGTWMKNGQAISATDRIHIVIDKLVHKLLVENVSRDDAATYSFFVPAQDISTSG
KLNIQTVEILSPLTDVTAVEGTKAVIETKISAADVTSVKWLHNDKLVMPSERIQMLAKGS
KQHLVFHRTFATDEGTYKLCVGKADSSCKLTIEKIHILKHMEDQVCTETQNITFKVEVSH
PGIAAVWTFKKQELKAGPKHKIEAKGKNYSMTVINTMKDEEGQYTFAAGEQTSSAKITVS
GGAINRPLQDVTVAESQTAELECDVANPTAEGKWLKDGQPVDFSDNVKHVKNGAVRRLVI
TITRPQDIGEYTYQVANSKTTAILRVESVKVKKTLTNQTVTETQEAEFSLELSHKNVKDS
QWIKNGVEIQPSEKYEVTVDGMVHTLKIKNCDTRDESVYGFKLGKLSANARLNVETIKIV
KKPKDVTSLLDATASFELSLSHDDIPIKWMFNNVELKPSENIKMLSERKAHKLIIQNVKT
NNHGEYTAVVGNLQCSASLHVEALRVTKPIKNIEVPETQVATFECEVSHFNVPSTWLKNG
VEIEMSDKFRIVVQGKLHQLKIMNTGSEDSAEYTFVCGNDRVFATLTINAILITSMLKDL
SAQEKDTITFEVNVNYEGITYKWLKNGVEIRSTDRCQTRTKQLTHSLTIRNVHFGDGAEY
KFVAGSAASSAKLYVDARIIEFTKHIKDIKITEKKRATFECEISEPNVQVTWMKDGQELD
ISERYTVSTEEFLHRLMIQSVCMSDAGGYSVIAGASMSKAHLTVEGKDVCITEPAEKKMT
VVEKQRTTFEFEVNKDDIEGRWLRNGIELQFSVDQRFSYACIRKLHRLTITETCRSDAGE
YTFIAGRNRRVVTLHVNIPEPPQIINHMQPLSVESGKPARFSVEVTGVPQPQVFWYKNSQ
ALSPGFKCKFLRDGNEHCLLLIEVFPEDAAVYNCEVKNEGGVATSSAALNVEVSEVVSPD
TGAPLSPPTIVSPISNTSTTEGESARFQCKVSGEALKISWFRGEKEMKQSNFFKMSTFDN
TCQLEITRVCSEVEGEYTCVARNPAGMVTCSAHLKLDGQKLITDITSDSQKHVSSSISTS
LSSVKKEQIAQRPTFIHPIEICMVQHGEVARFHACVSSMPKPEISWYHNQQPIKPTKDIV
FHSDEMTNTTTLIIVAAFSEHARQNTCKATNNAGEAVCTAALAVTKEEVTNMKEEIEATI
EQEVKEFYNKRTVFRENRGQMRGAFSDTEEVLDQANNSSIKPSFKKRLKFQNVLEGEPAV
FRCRLVAFPTPTIIWFHNNRQIHKERRRRIRTESTLHMHETSLVIDSIKDKDSGSYKVMV
INTEGSAESISSLLVSMREAQEGNDLSHIRRSTRLHGSLDSLVDQKKERKCRVNLRCVGS
PFDQKFKPSGRSRSKDAPVRTLHFRSSSPTRGKDKETNLNETASERALSPPSIFGGERVT
RSERFNDRYIDIYCDRHTGRFSDKFSDRCSDRFSDTESLHEEVKAKLGLLQNAVKRKKRL
SMSTLSSSEFDLESNASETSYADYVDRLRVKKPASLPGDLQHARPFERNVRNDKVSAEFY
GRYDRIPTHCAESTQPRVRHSFEPQSRTRAIQMLKGDLPATGNEKNFDEGVSETHMDKTV
LTPGEPQHELGFEHKIGKDLENQGAQYIGNQGEDYLGKKLSEDLKTKMEGPFVFACPETR
RSLNIAEKDEFSRTSSNKPLKEIFSSKTTNIQEDTVKSTEEQFEKQPSFAENRYENTESE
CEDKLLALRIRKWQKGMQMDQEEQFKHETDHSKARDLPYTQSKILYGEEVERKTDTKTVS
VNEEKSWEEHHPSLEKVCLTRENVYGLKSGTEQNLSLSQTKDESACEKKTGEENTVSQEK
IHELNLSHSPKERHVNMYGEEVDRKTATETEALNFQHLPSSQKKSPAESSEVTWEEDHLS
LKKVSLSLKNIAPFQNVSLSQSKERSANEKKTGEEHHLSQENIYGMKSEPEQNLSLSPRE
MRASEKKHQEEQCLLSREKTHKSEMFGSEEEALGHRIIKWQQDVLTEQGFAVDLDSDWVG
AEYSPYIARKVAESKMAAEGITLGSTAHSEADSTRRRKPSPEKTDYEKLLTEDVPHGFRD
ERRSSLEKTVKEHVLTENDIPPEYRYDRSSPEKKTNEKFLTEDTPHEYRDVRRKSSPEKT
TKEMLLRDARAHEGPRRPSTEKTSKERFLSEHAPHDYRDERRRSSPERTAKEKSLSKDVH
HDFRDESFQWPPPPQTVVDETRMQTTESEYFVSEEEALAQRILKWQEDVLTEQEEAVELE
SNWALAEHSQHSKKSDASGPHEGSSNEPVKERSPVKEPSLMRQHHIGQYESSSFEPVSHQ
NEKSRTMSLGFSHVKEHSPVKEYSPMRQHRIGEHVSQEDWAMAEHRRRTDVSGDDANEGP
SYEPVSHHIEKFHQMSLGSHSPVRGSSSVRETSPGREPSPGRERSHDRGQSPVKEPGREA
SSGRCCSPLRELHIGQHGSQAEVGAEGPSNWESDLRHNENVAIRTAERKEGHREMLSKEN
LHQIDMPQRTKEVKTSPKTSVPIFVREISSLKVKRGEMTDFKCSFRGDPQPIVTWLKDDQ
PIGQNPDFDVLTKLNETTLTIYYPTIYHEGTFSCVITNTFGKSTSSATLEVTESKQLRKL
PSPVASYKVKVTTEYEMSEEDLDQMIDDELESYNGVEMDEKSLLQVPQAVLHRPCASDTS
QYSCSPVEIRITAPTPVPFEMIGKDTEMSEDDGSSHPMKHKFTFCYDAAQVVSESEKISS
SEGQTGKVEIRSDVSFQSAVTIARSSEVEATMAGEWEQHILSGNSEDLRQSPLSDTGHIS
DPTLMQTLNKSVGSNNPKDNVSELARSEADMANESKQHILSRFSEDLRHSPLSHTSDITD
QALMQELDNSIGSHSPEEYVSNVSKPKQSVSKEAPTITGCGLQSSAAPVKVSQMKQAFEA
PGLSEAPDLLDTTSVDEVKKSTESYFPEEYIPEVAIHLDHDDKSLATNVVEGTPLQSKQN
SMLVEGSDTQIPRAKLISAKSGPEVVLLGGAQISAKVKSVSPKCAPVGVQAMSDTLEEDN
EICMISGETVEEADIIDTHSHLSIREVQVSPTLVRPEAVKAVKTSHSTECMGPHVKDQNM
IEDSLCEKVPVLVTPDDVSASVCDESVELKRLSGSFAAPEIHRLDTQSSVGNDMTDINEN
LSLSELLKDSAFVSVTWAHSEIVSEETAEENEEHAVAESGEPSVVSKSINVKLKGDGCTD
YLAAQGPQHQAEAKPESADLSTAVSEGASGVISLEEEVVTFSTVYDYYHPPTEWGRPLSP
ESDMSIECGSTFSEELTEIEQFYTPDSSNENLQLPKTPESFHTPETETPAGYMTPNEYAF
SPLERKRPSTDSSERLFSPAKFLRSPDDEGIETTPPAFRLDEGRFLSERALGLGGLQEKV
QGIPPAFLKPLTKRRVFEHDSLSFYAELFGLPSPEVKWFRNKTQFVADERITMDRDGDNI
WLVIQNITKADQGEYICEAVNYVGEAKSVALVVVISNEARXMXPPPXVTQQHVMEFDVEE
DDDSSRSCSPQEIXFEVEXDENEVKEFERQVKIITXPEYTADNKSMIISLDVLPSMXEES
GVDFVTQERDDLKIAFEVTEMPPRFINPICDMETPENTTVMFECSLMGIPSPIVSWFKGN
KKIPHDNKKYLYSSDGDNHFLKIRNVSAHDSGIYTCRAINVVGETLCRASLLVLNPKSFI
GKTRGRELTAVSLGSAKVQPQKFDLVVGTEFDGEQASEIELEFEFEQEADESQKAVRLVA
MTNNEMSEQGQKYVSINFGVFAEPAKDDKIVFKGKSSELCSFRFQMTETPPKCIIPLTNI
TAAVGTPVVLQCLVNGKPHPTAEWYKDGDPVKDTRYMIQEKASGHFNLIITNVTQKDAGE
YKCLIQNKSGYTETTGLLNVLNNPDGSGFISMKGIQQQDSGLYTCYKVSMSAEQATESHL
YEVKLPGEARASIQAGHQMVYTIGTEDSHVVKTLRELDNSAATFQKEKVTHQAAVLQSHE
LESTKLVVKGSAVKLECKATGTPEIIFKWFKNEIEMRQNEKYKMAVTNSVASLEIANCSV
DDSGDYINCKISGSLPITVEWQKDGNRIDVGGKYKLVRQDISMSLEIRQLERADAGTYSC
KLTNKAGSVECSGAVVKAPPSFVLLPESHTALPNSNMXFKSTFKGTPPFTVKWFKDDTEL
ITGPSCFTGLEGLSCFLDLYSVGVLQSGIYSCQFKNYAGIERCSAALMVKEPPEFVLKLP
VTKFVKKCEPLHLECKVKGAPSLRMQWYKNDTKITDGDNYRISFVDSMAVLELRTTRFDD
NGVYTCEATNDAGSISCSTTLRVKDAPSFLKVLRPIEGMKGKDASLHCEMFGTAPFEITW
AKYKTPLKESRKYKIVNEVTAATLHIIGLEASYFGEYKCKAPNSIGYETCRTTVKLREPP
TFVEKLLNTTCTLGEEVTLTATVKGSQPMTASWIQDKDHILRDGDIQKITFENNQVPLKV
FKADSLVMGKYTCQLRNDAGVVECFSNITVLEPAKVVERPESFSVTAGDIAALEVKVSGT
PELKPKWFKDGVELSSGQKYNISFSKMISSLKVLSAERIDMGEYTFEVKNEVGSDLTKLN
LTVLDKTIPPTFTRKLKESQPIVGKAGEMDCKVSGSAPFTITWYHDEEEIKTGPNYEIAF
SDNTCTLKVPTLKWSDSGVYKCKAVNKAGTNETSASFIVKEPPSFVMPPQPLEAMPGTNV
TFSAIVKGSAPLKLKWFRGTKEIVSGKGCEIALRDNTATLELSKIDKFHAGEYTCQIIND
AGMESFLVNLSVKEPASFVKKLNDHSVEKGKSLILECTYTGTPKIFVTWYKDGKQLYASY
KHHVTTTETSCILECLNSDDKEASGEYACEVSNDAGKDTCKAQVFILEPPHFIDHLEPME
VTAGDAVCLKCHVGGTPEIKVAWFKADGKVRSSPNCKIEYSKGIACLKLSKAAEADIGEY
TCKAENRIGSASSSCRLSVQEAKTPPTFPKKITSIQQTEGKEVKFECRVAGSSPIEVSWL
KDGETVKSNDYTMSYDDNTAVLQISRGEMRHSGEYTCVATNSVGTASCRAKLTLKEPRYP
PVFDKKLSPVVDVSVGDSVELECHMTGSLPLKVTWSKDHKDIRSGGNYKMSCVDNTPHLT
ILKADTSNYGCYFCHATNDIGKDSCSTEITVKERKIPPSFTKKPTETLEETEGKMVKIEA
RLSGSQPMTINWYKDDSEIHSSDHYDMSFKSNVAVLCIKSSKVSDCGRYTGTATNEAGTA
SCKLTVTITEHKKPPTFDPALKPVTLTEGENLHLSCHVHGSPSMTIQWMKDRKDLKNKSS
SKISFADGVASLEVMRVSKNDAGDYLCKATNEAGSEFCKAKVTIKGTPEKSKAAPEPAEE
EPTAAPVKKLDNLFFIEEPKPCHVAEKGTATFIAKVGGDPIPNVKWMKGKWRQITHGGRI
TIEQKGQEAKLEITEVTKSDSGQYRCVATNKAGEIECSTDLNVDERKEDAGVEGDFRAKL
KKTPSKQKSPREEKDIDIVELLRNVDPKEYEKYARMYGITDYRGLLQAIEQLKREKAEGS
GRPEPERERELDEDLVALVADLQKRMECTEPVTVNKDITDQSTVTNKVATFECDIKINYP
EITLSWYKGTQKLDNNDKYEINIVGDRHILKIKQCQTKDQGNYRVVCGPHISSAKLTVIN
PEVEKHLEEVAGQEGQTCTLSCQFSIPNVKTQWFKNGKLLEMKRRYSYEVVNNIQRLSIK
DLRPEDQGRYTCKYENLESTADLLVEAQRVPVEEESVQSKKVGMREEMPQKVSEAHKKPE
EKPKPAEAAEPHKEPAMKKESPPQPVEPLTKKVSQLEKTVVAEGVKESEPFAKKVAKPES
KPEIKLESKPEKRVIAEKPAETLVKKVFTPESKPEPKPEAKTEPKPKPEVKPDPMPEPAE
TCKESDYAEKTVIADVVKESPPKPAETLVKKVTTPEKTVIADVVEESPPKPAETLAKKVA
KPESKPETNTKKMAIVPVKKKETLPQPTEPLVKKVPKLEKTAVSEEVKVTLPKPAEPLVK
RVSSPESKPEKMNAEEVKESPLKPAEPIPKKVPKPETMVIAELESPPKPTKPLVKKVAEP
ETKPEKIAILEEDVPKKVPAKEKESAPKPAEPLAKKVPKPEKTAIAEEVKESPSKPAETL
LKKLSSPESKPEPKSEPKPEKKAVAEPPKPAEPLLKKVSKPESKPEKNAVAEPPKPAEPL
LKKLSKPESKPEPKSESKPEKKALAEVVSLSSEDYVAPPKAVTVEPEKDKDKESVVFKRV
QKKSPQEKSDGAPPKKVPGMKELSPKAVQLRKISTQLEEEVFEEEPEVEEESDNEGWGWK
LVPRDSSGSTEDWGEEGDALETPGMPRRDGKPAEEAGAGRGAGRGRGLKAGKTPSPGEGR
GRGLKPGGGGGDKPPDANPFGFQLKAVPLKFTKPLKDIVLQEGDAVGASATFECEVSPST
AVTTWMKDGSNLRESPKHKFTSDGKDRRLAIIDVQLVDTGEYTCVAKLGNKEKTTTAKLI
VEELPVKWVKELGEETSVLKGQPMYLTCELNKEREVTWMKSGKVLKVIAGKVAINVIGMQ
QAVTIQNMGDDDAGIYACECELIRTKTTVKIIEIVRDWLVKPLKDQHVKPKATATFKCEL
FKETPNWKFFKGNDEIPNDPTDKTEVKKEGKVLTLTIKNAQPEDIAEYTMEVEGHRYTAN
LTLGEREAEILKPLSSCEVVEKEDVTFETEISEEDVPGEWKHKGQVLTRSPTCEIKMEGN
KRFLTLKSVPLDASGEVSYTALNAVTSAVLTVKEMEMDFTVPLNGMSVPEKKQAMFECTI
TRDVPEVMWLKGSDTIGTSDKKYEIINDGIIHMLVITHNGEFDDEGNYSIEALGKNSTST
LTVEGMRLKFELRLQDQTEKEGNTARFELELSHENVPVTWYKNEVELHVSRTVLIHSRGK
KHALEIKELTLDDICQVKAEAKGILSMAKLTVIEGDAYFVVRLQDYTAVEKXELSKDVPV
MWYHNETEMKASKMVTIRAEANXRMLSIKKVEDXDKGQYVCDCGTDKTMANINIEARDID
ITRPMYDVELFEGKTAHFEVEISEDDVHGQWKLNXEVLTQSPDIETIEDGAKHTLILYNL
KAPLSGEILFTAANAKCVANLKVKESPITFVTPLSDVQVYEKYEVRFECEVSRVPKGFRW
LRRSHELTADDKFDITHEGKRHTLVVKSAAYEDEAEYIFEAEGKRTTGELVIQXIRLEFV
KPIKDVMVKERXTAEFSIEARQQSSVSHDNIQVTWYKNNVRLHPSQVVHMSDDGKMHKLT
FKGVSIDDTSMIKVEAMDKISEAMHTVLEGKPYFTTKLHDYSVTEKDELTMICELSKPNA
EVKWFKGDQQITSSKNVVIKADGKRRMLIIKKTEKADIGEYSCDCDTDRTTAKLNIEDRD
ITFVRPLYSVEVTETEIAKFETEISDEDVHGHWKLNGEALHQSPDCEIKEEGTRHVLILY
NVRKDQAGEVDFQAANAKSNAQLRVKARVIGLLQPLKDVTVTAGETATFDCELSYEGIAV
EWFLGGTKLEPSDRVVTRAEDKTHTLTLRDVKISEDGEIKLTAKDFQIEARLHVNEPPVE
FTKPLEDQTVEEEATAILECEVSRDNAEVSWFQDGQEIRKTKKYDIVADGRIRKLIIHGC
TLDDSKTFTCDASEFKTSCFLNVEPPHVEFSKPLHDVEVKEKESARFECEVSRENAKVRW
LKDSSEIRKGKKYEIIAKGRQHILIIHKSVFDDEAEYECDAKVSKSSGLLTVVEEEATFT
RNLSNVEGTEADSVKMICEVSKADADVMWYKEDQELPEGGRYDQIVDGRKRILIIQDLKT
DDAGEYYCKLSSSQTTGNLKINELAAEFIAMPQSQEVVEGEKAEFVCSVSKDTFIVKWMK
DDKELEKGDKYDIVCDGKRRILVIKNSEPKDEGAYVALIGTTRATADLFVLEKLRINTPI
KDTEAKEGQEIIFNCEVNTEGAKAKWLKNEETMFESSKFVMIQKDNVFSLRIKDAEKSDE
GNYTVTLTNQRGEHAKSSGKLTVKEESLKIIVPLEDCDTQEKKTVSFSCKVNRQKVTLKW
TKAGQEITFSKRIIYRLDQYKHTLTIKDCTLADEGEYTAIAGDDKSTAELIISEAPTDFS
AQLKDQTIPEFENAEFTCKLTKEKAEVKWYRNGREIREGPRYVFEKEGKTCRLRINECRP
DDECEYSCGVDEKRSHAHLFVEESAVEIVRPPKDVFEPPGSDVVYEVELNKDRVEVKWLR
NNMTIVQGDKYQMMSEGKVHRLQVCEIRPRDQGEYRIIAKDKDARAKLELAAKPNIKTMD
QSLVTDAGKPIVMFVPYSAYPKAEAEWFYDNVSLPKDNIHTVGDRTEYRLKDPKKSDQGR
YKVVIKNKHGQGEAFINLDVIDVPGPVKSLQVLDTADGEVSLAWEEPESDGGSKIITYVV
ERRDVKRKTWTLATDRSDAPEYTVTGLQRESMYLFRVSARNRVGSGPNIETEKPGVYAKN
KFDVPDAPQDVSVGNVSKFGATVSWEKPVSDGGAEITSYIIESRDRTSVKWAVAMISKAT
DRSAIINDVIENKEYIFRVKAENKAGIGKPSAATNPVKIMDPIERPSPPQNLVPSEQNKN
SVQLTWETPLKNGGSMITGYIIERCEDETNHWLRCNARLCQDLTYKISGLKYGKKYNYRV
MSENAAGVSDPSNTLGPMLADDTHVGPTMDLSGLKDGLEVIVPHPLTIRVPISGYPTPHA
KWSFADKELTAGERVYIITKSTYVELTVTPSVRPDRGVYALTLENDITSCSGEIEVNVIA
SPSAPKDFKVAEVTRQHVHLMWEAPEHDGGSPLTGYLIEKRDVSRKTWVKVITGVQDQEF
TVTDVVEGKEYLFRVTACNKCGPGEPAYIDEPVNVSSPATVPDSPENLKWRDKSASGIFL
TWEPPKWDGGTGIKGYNIERCQRGTDNWESCGDQVPEFKLQVTGLIEGQWYAYRVKALNR
LGASKPCKATDEILAVDPKDPPEILLDVKCLAGLTVKAGSKIELPADVLGKPLPKVKWTM
GDVVLKGDDRVSIDDKPGHSVVTISKTTREDTATYIIEAHNSCGRATATIDVNILDKPGP
PAAFDISEITNKSCFLAWNPPRDDGGAKVTNYIVERRAADSEIWHKLSSTVKETNYKALN
LTAFKEYIFRVFAENQFGIGVPAEHMPIIARYAFDSPGAPTKLEPSDIVKDGLTLNWYEP
EEDGGSPITGYWVERFEPDQNRWIRCNKIPITDTTYRVKGLPTRKKYKFRVMAENLAGPG
KSSKETDQILVKDPIDPPWAPGKPSVKDVAKTSAFLQWTKPEHDGGAKIEGYIIELLKSG
TEQWVRVSEGINILEHFLRGLMDRQEYSFRVIAVNIAGESEPSDPSDPVLCKERLNPPTP
PRWMNVITITRNSAELKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKELKYTVTP
LNEGSLYVFRVAAENAVGPSEFCELEDSIMAKDTYTTPGPPYNLSVNGVSKRHVDLEWDA
PKNDGGRPVLRYSIEKKEKLGTRWVKCGKTSGDDCKYRVTDVIEGTEVQFQIRAENEAGA
GHPSEPTEIIAIEDPTGASSPPIELHLTEASRDHLCIAWRPPERTGGSAVTGYHIELCEA
GTEKWMRINSRPIKELKYKTEEGITPEKQYVLRVRAINSVGVSEPSDISEKVYAKDPDCI
PTLEFQTKDIVIVEGEKWHLPIPFRAVPKPKITWHKDGKELKDDERRSFRQEYLSCHLEI
ESCLHADSGQYKVTLENSLGASSGTINVKVVGLPGPCKDIVASEITKSSCKVSWDPPNYD
GGSPVLHYVLQRREAGRRTFVNMMSGENKVSWPVKDLIPNGEYYFQVKAVNKIGGGEYLE
LRNPVIAEDQKQSPDPPLDVETHNPTSKTITLTWKPPMYDGGCKIMGYVLEKMMKGDENF
TRCNDFLVPVLSYTVRNLREGKQYQFRVRAENAAGVSDPSHSTPMVKASDAVETPKVFLS
GSLQSGMSIKRGAQIRLDANISGSPYPQITWYRNDVVIRPEAMKKRPEKPIVKKKKEGKK
EVKEGEKKEGEVKESEKKEVKDEEKKEVKEGEVEVPATEAPAAEPAHEEPEEEELPDYPT
LQERLTIHDKKRGESSCIVRDTIRGDHGVYTIKVENDHGIASATCEVNVLDAPGPAINFR
FEEIRKTSVICKWDPPMDDGGSEILNYTLEKKDNSKVEIGWITVTSTLRGCRYPVTKLIE
KKEYIFRVTAENKFGPGPPCISKPLIAKNPFDPPEAPEKPEIDGITANSMLVSWEEPNDM
GSPILGYWVERREINSTHWTRVNRVILEDTELNVEGLLEGLTYIFRVAAENQAGPGKFSI
PSDPMTCQDPILPPGPPFPRIIDTTESSIDVEWDPPASNGGGDILGYHVDKTVAGTKDWS
RSTERPWKTRVFTVYGVREGAKYLVRVIAVNGAGEGTPGLTESVLVRDPKEAPVVELDLT
VRNGVMIRAGEPLILPALVTGRPPPDIKWTKDDGPPDKDHVEIENVGKESILSIKAATRK
DPGKYQISARNSSGIKSTWTRVEVMDVPGPVLDLKPVVVTRKLMILNWSDPDDDGGSDLT
GFIIERRDPKMHTWRQPIETPSSKCEIVGIVEGQEYIFRVVAKNKFGCGPPVDLGPIAAV
DPKAPPTSPERFHYTERTKTSISLAWRPPRNEGGSPILGYFVEKKKHDAPAFEPCNTEMC
KDLFMTIENLEELFMYEFRVKAVNLIGSSEPGIPLTIVIQDDEVPPTVRMLKTFKGDAIT
VKKGEPIEIPAEVTGLPMPKVEWLKDEVIIVEPTETLLMDTKEINRMQCNTKLSIPAAAR
LDKGIFTVIASNRLGTASHTIKVKVLDRPLPPRNVNIGNIKAESCQLTWDAPEDDGGSEL
TNYIVEKLDILPEEEPEEEYEDSEDEEPKPKSEPRPIPVWTVITNSIIEKRLGVWNLETG
SQCQFRVRAENRYGQSDACETEASVIKDLYGLPGPPEKPKIAEHTRSSMLVTWDPPRDNG
GSTISGYWLEKREKGSSYWARVNKAPVTKRAAKRWEFQVVRMIEGSAYEFRVMAVNIAGT
GPPSGPSDPAYAVDPLMKPGMPAAPEVADKTKHSVSLTWSPPEKDGGSAIKGYIVEIQDE
ASSIWIRITDLETLHETTEITVPSLKELKHYKFRVTAVNDIGESDPSPKTEVLIEDVHVE
PKIHIDCVVEDFLCVRAGHSFRIPAIIKGRPVPKVTWEFTGPAKTHKKNRLHVLPVDSEL
ESTDTTSNITVPVCLRTHSGRYTITAKNKAGQKHVNVRVNVLDVPGAPRELKVTDITRAT
MRLIWKLPANDGGERIKSYFIEKKNVTGKAWTIVNQCCFSQAYVVEGLLEGQEYVFRVRA
ENRLGMGPLTETTEPARARDPIYIPDPPTHVKVNLVTKDTVTLTWVPPKNNGGSPVKHYI
IERLSWDTSGPEKETWKQCNKRNVEETIFIIEDLKNGGEYEFRVKAVNEAGPSRPSATAG
PVIIKDQTCAPTIELKEQMEGEEGLDVHIVARIHGCPFPSLVWQKAPIAKPEDKAVVQYD
QHVNKLIIDNKCTLLIQQSKRDDSSLYTITASNSLGKASKEIKLTVLGRPGVPVGPIEFK
EVFAERITLAWKPPRDDGGSKVTNYVVEKREENRKSWVHVSDDPKEGLYTVQRLTEGHEY
EFRVMAQNKYGVGPPLYSEPEKARNLFTLPGPPTPKVTDWTKSTVDLEWIPPLIDGGSKV
TGYFVEYIEEEKEAEIEKQKAKDKEIRSTKFVVSGLKELGRYKFRVRAVNAAGVGEPGQV
AEVIECKDRTIAPEVDLDASVKEKIVVHAGGTIRLLAYVSGKPAPEITWSRDDQPLPAEA
KVETTSISSALVIKNCRRHHQGIYTLSAKNEGGERKKAVIVEVLDVPGPVGQPFSGVNLT
IDSCKLTWYSPEDDGGSAITNYIIEKRESDRMGWTAVSYTVTRHNAVVQGLIDGKGYFFR
IAAENIIGMGPFFESERPVLIKDPISVPERPEDLEITAITKDSISLAWRPPKYDGGSEVT
RYVLEARLIGKDNFNKIDTDDTLMDRKFTKGGLKENSTYEFRVSAVNVIGQGKHSFCTKP
IQVKEELEPPTIDLDFRDRPVVRVGDVCTLQGRFTGKPAPTITWTKNEEELKADEEVTMT
NTSKTLCLAMPKAKREHSGRYQVVVENIVGLRKGICSLTVVDRPQPPEGPVVFNEVYRNH
MVISWNPPLDDGGCAISNYTIEKRDTNRDLWMPVTTACTRTTCKVPKLIEGREYIIRICA
VNIHGVSNPLLSAETKAKDVFKVPDAPKQPIVKEIYKDQALLTWEPPADGGKPITGYVIE
RKETMANRWTRASGKDRIFPKVEYFVPDLLKGCEYEFRVMAENVVGLGDPSPPSKPIFAK
DPIVLPSPPVLPEAVDWTKESVSLSWQPPKDCGRGKIFGYLVEFSKAGEEWQKVNQTPDS
CQETKFKVINLEEGEYYKFRVTAVNFAGESEPAYTTDPVKAEDRFEPPELDVELGMPREL
KAMAGTHINLVAGIKGIPFPKVTWKKNDKDVPTRAEIEVNPLGSKLEMRYCARSDCGDYT
LNIENSSGSRTATCTVLVLDKPGPIQHLRVSEVRSDSAYLSWKDPEDNGGARITNFVVEK
KDVAAAQWVPVCSSSKKRSMMAKHLMEGTSYLFRVAAENQFGRSEYIETTKAVKAMNPLF
PPGPPKDLHHVDVDKTEVWLVWNWPDRNGGSNIIGFLVEYQEEGEREWDEWNTVSIPESH
ITGLEEGKTYRFRVRAENAIGLSRPDTTVPVLCQEKLVAPIVEVEAKLIEGIIVKCGSTI
RLPAIMRGIPAPTAKWSIDGAEIVPEGSVKIESDNYSTVLSINECMRTNSGTYILTVSNP
AGTKTLALNVTVLDVPAAPIGPINVLEVTPEYMLIDWRSPKDDGGSPVTGYIVEKREAKK
ETWGGVSSGSTATKLKISRLQSGVEYVVRIRAENKMGIGAPLESAPTVAQHTFEPPAHPG
KPNTWDIAEDALTVGWTMPLFDGGSQITGYIVERKHKGGKWIRVNTTPCKDLRIRVLGLF
EGNEYEFRVFAENIAGFSGPSAISDPAKPCRQIKAPGPPVNPRIKDYSKENADLVWIKPN
KDGGSPIMGYIIEIQKVGGEWEIINKDGHIKQCAYRVKGLEEHSEYRFRISAVNMIGVGE
PRECLGSVVAKDIMIPPEIEMDATSRECLTVRVGHNINIIGYVKARPDPEIIWKKGEDVL
ETAKHTTLTQNLPVVQLRIKEATRADHGKYVLKANNYSGEAEATITVNVLDRPGHCQNLK
ATYVTKDSCMVSWENPVDNGGSEITNYIVECREPSVRLWSMISSDCTNRMVKAKLMEGHE
YLFRVCAANKCGPGPTVETKQPTLAIDPINTPGEPENFHVTDVGKNFVFLKWRRPDYDGG
SPNIGYALESKEAGAAEWVPLHEDLITSTFFMADKCVEKQTYQFRVQTCNEGGESDWVKT
GDVLVKEEIQKPVLDIKLAGALVVKARESIRIEAGLRGKPQPEVKWVKDXATGDNPRVSX
ETGTDXSKLLXTKSKRTDTGKYVLTATNSAGTFTGYAVVHVLDVPGPVRDVKVSGIGVDK
CRVAWDLPEDEGGCEVDSYIIEKCETRRMVWSTYSASLVTNYCNVTRLVEGNEYIFRIRA
ENKMGTGPAVESKPVTARTQFNRPGPPESPEITKIGKEEMTVVWAPPENDGGKSITGYIL
ERKEKRAVKWVPCTKSTISERRMKVSNLIPNHEYQFRVKAENEVGLGEPSKPCRPVAAKD
PIETPGPPGSFKVIDSTKTSITLGWAKPIYDGGAPIIGYMVEMRDKPEPKPEVVEAEAVP
EDKPADEAKPEGEAKPEAAAGEGEEKYEEDAEDEAAAVAAKAKAEAKRKEKEEGWKKCNT
GAGVLVHTEFTIPNLNEKQMYEFRVSAQNQVGWGRPATLKEAVNPKEVLEAPEIDLDASL
RKGFTVRAGCPIRLFATIRGRPSPKVTWKKLGVDNVARRGHVDQIDTMSFLVIPESTRDD
SGKYSLTLSNSAGEKAIFVRVKVLDTPGPVGGFEVCDVTSTGCQLSWLPPDNDGGCQIQN
YIVEKRELDKKTWSNCINDLKKTSFKVTGLTPGCDYYFRVMAVNKYGIGVPKDSPKAYLT
TDPISEPDPPKKMDVLEVTKNSATLGWLKPLRDGGAKINGYMVDYKEDGEPEDKWTPYSV
VKDLTIVVVGLKEGTKYKFRVAARNVAGTSLAREAEGVFEVKEQLMAPKIIMPDIVTVRA
GEKMRIDAIVAGKPTPFCKWRQGADDLLTSDRLMVQKSPNCISLIMKDVSRKDSGYYSLS
AANSTAKISQILRVIVQDKPGPPDAPLEIVELDIDACTLQWNQPSEDGGSNITNYVIEKC
DVSRGDWVIASGSCTTTSYRVGKLTPGMEYGFRVRAENRFGISEPIYSEKSIARYPFDVP
DEPRNLCITKVKSEAVSLSYETPSTDGGSPLTGYCIERKERNSLLWVRANESVVRGLEYN
CTGLMEGLEYAFRVSALNKAGQGKPSKQTDWVTARTPIDPPGKPEVMDVTKSTVSLVWTR
PQNDGGSKLIGYYVEYMKIGQEVEKWVRCNANCQNVKTEDYVVTGLEEGAQYHFRVFAKS
AINISLPSQISDAIPVFAENVPPRVELGVDMKNMIIVKAEENVSFDAVVFGKPLPKVTWK
RDGVPLKLVDGMKMTQKRHTHILELFSVARKESGEYTILAENPNGAKYANIKLKVLDKPG
PPAGVKVTKVFADRIKMRWEPPVADGGSEIINYIIDKRETSRANWALVTSNIHGQLTDCT
VDKLMQDHEYQFRVSAENQYGIGDPILTDPVMVKNPY
NT seq 50152 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacaggcaccaacatttacacagcctctgcaaagcggtgtggcactagagggt
agtgctgcaacgtttgaggctcaagttagtggtaatccagttcctgaggtgagctggttc
cgtgatggccaggttctttccgctgccgctctgcccggcgcacagatctcgttcagcgat
ggccgcgctgttctgatgatccctgttgtgacagccgcacacagtggaagattttctgtg
agagccaccaatggtgctggacaagccactagcaccgctgaacttcttgttacagcggag
accgcgcagcccaactttattcagagacttcagagtatgaccgtgagacaaggaagccaa
gtgagactggatgttcgtgttgcaggaatccctacacctgtggtaaagttctacagagag
ggagctgagatacagagctctgctgactttcagattgttcaagaaggagacctttacagt
ttgttgattgccgaagccttcccagaggattctggaacttactctgtaaatgcttcaaac
agcagtggacggactacctccactgctgaactgctggttcaaggggaagaagctgtgcct
gccaagaagtccaaaactgttgtgtcagcctcctctcagaccagagttgagacaaggagt
atggaggctcattttgaatcctcatcctcatccatgcaaatgcgtgttgaaggtggtgta
gtgagccaccaagcacacatgaccccaccacgtgtgcctccaaagccaacctcaacctcc
aagtccccaacaccaccatctcttgcagccagagttgcaggcggacgtcatcagtcacca
tcacctgtgagacatgtcaaggtgcccactccggccccttttaggcttgtatccccctca
tcaagactgtctgtgtccccaatcagaccagttaaatccccactgaccacacgcaaaaag
gtagcccatggtcctgatgtccccccaccatggaagcagggagacttggtggaaggttcc
agcagctattccagcagcatgacttctagtgccacccatgcccaggcttccatgtctgcc
acccatgttcacatggagcagcactgggagggctcttatggatcgcaaacgactggtgcc
gctgtatctggtgtcgctgtgaaagagatacgaagaagtacagaaactactatcgaccac
gtggatgctgcccctgcaccatccccaattccacatttcacagtttcaaaagttactgtt
cctaaacctgaccctagctatgagattgttgagactgcagcagtcccatcccatgcagaa
gagccagttatgccacctactcttgtagctggcttgaagaacgtgactgtgactgagggt
gaatctgtgactctggaatgtcagatcactggtcaccctgcccctggcatcatgtggttc
agagaggactacagaattgagagctccattgacttccagatcacttatgagagtaaatgt
gcccgtctggtcatccgcgaggccttcgtagaagacagcggtcgcttcacttgcactgct
actagcgaggctggaaccatcagtacatcctgctacctgcttgtccaagtaactgaggag
attgagaccagggaagatatgacacaagggctgacacagcaggaaacgatgacacagcag
agaactgagaccatgtcagaggtaaatgtcaccaccgcaggttcaccagtagatactgca
gatgctgtcgctcccttctttgtcaagaagccaactgtacagaagttggtggagggcgga
agagttgtctttgagtgccagatcggaggcagccccaagcccaacattatctggaagaag
actggagtgccccttactacaggatacagatataaagtgcactacaataaggagagtgga
gtgtgtaaattggagatctccatgacgtttgctgatgatgctggagagtactccatcttt
gtcaagaacccgcttggagaggagtctgcctcagccagtctactggaggaaggggaatat
gaagaatacatgaagaaacatgaaatgacctataatactgaagtgactacggtgcaggcg
gatgtttcccctgttgttgtgagcgaatatgacgaggaccagaagtatatccagagaatg
gcacagatgcaaagctttgttagaacgcaggaattccagatttcttcatttgaggagagg
attatccacgagattgagatccgcatcttgcagattacctaccaacaaattgtgactgag
gatcgggaagagatggtgactgtggcagaccgtgaggctgtacagtcagcctttagtact
ccagttaaaaactacaggatcatggaaggaatgggggtcactttccactgcaaaatggca
ggaactccactacccaagatcgtatggtacaaagatggcaagcgtatccatcatgggggc
cgttaccagatggagagtcttcatgatggtagagccagcctgcgtcttcctgtggtgctg
ccagaggatgaaggtgtttacacagcatttgccagcaacatgagtggaaattctgtgagc
tctgggaaactgtatgtggagcccactgccattgcagtagctcagcgttacacgcctgaa
cctcaggcaatgcagagaattaggtctcagtccccaagatctctgagtcgctctcccgga
cgctctactagtcgctctcccggacgctctactagtcgctctcccggacgctctactagt
cgctctcccagacgctctcctgcaagcaggcttgatgacactgatgagagtcagctggag
agactgtacaagcctgtgtttgttttgaagccacagtcattcaagtgtgctgaagggcag
actgccagatttgacctgaaagtagttggtagacccatgcctgacactttctggttccac
aatggacaacaagttgtcaatgattacacccacaagatagtggtgaaggaagatggaact
cagtcactgattgtggttccagccatgccccatgactctggagagtggacggtagttgct
caaaacagagctggaaaaagctctgtgtccataacacttacagttgatgccaaagagaac
ctggtcagaccccagtttattgagaagctgaagaacatcagtgtcaagaaaggcactctg
gttgagttggctgtcaaagccatcggaaaccccctgcctgacattgtttggctgaaaaac
agtgacatcatctccccacagaagcacccaaatattaagattgagggcatcaagggacaa
gccaaattctatatcccacaatctgtgagttctgatagtgcctggtacacagccacagcc
attaacaaagctggacgagataccactcgctgcagggtcaacattgaggtggatgttgct
gcacctgaaccggagaggagactcattatcaccaagggaacctacaaggccaaggaaatt
gcagctccagagttggaatccctgcatctccgttatggccaagagcagtgggaggaggct
gacctatatgacaaggtcaagcagcagaaaccgcagtttaagaagaagctgacttctgtc
aggctgaagcattctggtgttgtccactttgaatgcagactgacccctattggtgatccc
actatggtggttgagtggttgcatgatggcaaaccccttgcagctgctaacagattgcgc
atggttaatgaatttggctactgtagtcttgactttgaagttgcctatgccagagacagt
ggtgttatcacctgcagagccactaacaaatttggagttgaccagacctcagctacactc
attgtaaaggatgagaagagccttgttgaggagggcaggagggaaatatacagaattgat
gagatggagcgcatggctcacgaaggaggtccttctggagtcactgcagatgagtattca
gagaagtcaaagcctgaaattgtccttcttcccgagccagcaagagtgttggaaggtgac
attgcaagattccgttgcagagtgattggttatcctacacctaaggtcaactggtacctc
aatgggcagctcattcgcaagagcaagagaatgagacttcgctatgatggcatttactat
cttgagattatcgatatcaagttatatgatgcaggatatgtcaaagtggtagcagagaac
cctgagggcacagctgagcatatggtgatgatagagatcacacagaaagaggacttcaga
tctattctccgtcgcattcctgaaccaaaggcacatgacactactgaacatggaagaatt
agctttgaagttgtgaaggttgatagacctgctgatgcccagcctaaggaagttgtcaaa
ctgaggaagactgaaagagtcattcatgagaagtccacagaggagacagatgagttgaag
agtaaatttaagcgcaggacagaggaaggttattatgaagccatcactgctgtggagctc
aagtccagaagaaaggatgagtcctatgaggatatgcttaggaagaggaaggaagatctg
cttcaccatcataaactgttgtctgaggctaagaacaagaaagacttggaagagggaaaa
ctcaccatccccacaatcaaaccagagaaagtacagctctctcccagcatggaagctcca
aagatcttggaacgcattgcaagccagaccgtgtctcagactgaggaagttcgcttcaga
gtcagagttgttggcaaaccggaacctgagtgccagtggttcaagaatggaatcctgctg
gagaagacagatcgtatttactggttctggcctgaagaccacgtatgtgaattagtggtc
agaaatgtcacagcagaagactctgctagcatcatggtcaaagccatgaacattgctgga
gaggcttcaagccaggcattcctgctggtgcaaggtaagacagttattacctttgctcaa
caactagaggatgtggaagctaaagagaaggacaccatggtgacctttgagtgtgagacc
agtgagccttttatcaaagtcaaatggctgaagaacaatgcagagattttctctggagac
aaatacaggatgcactcagacagaaaggttcatttcctttctgtactgattatcagcatg
aaggacgatgcagaatacagttgtgctgttattgaagatgaccacatcaggaccactgcc
agactcaatgtggaaggtgcttcactgtcaattgtgaagaggctggagaacattgaagtg
cctgagacctactctggggagtttgaggtagaattgtctcgagaggatgctgaaggtaca
tggtacttcaatgacaaggaaattacgcccagcagcaaatatgttacctcctaccgccgt
ggacgccataccttgtctgtcaaagacatcaagaaagaagatcagggaaaatatacattc
aaaatttacgatatgcataccagtgcctccctgaagatgaaactgcgccctgtgacactg
atgcaacccctcactgacctgacaatctgcgagggtgacattgctcaattagaagtgcga
ttctctcaggaaaacgttgagggaacatggatgaagaatggccaagcaatctccgctaca
gatcgcatccacatcgttatcgacaaactggtccacaagctgcttgttgaaaatgtgagc
agagatgatgctgcaacatactccttctttgtcccagctcaggatatctccacctctggg
aagttgaacattcaaacggttgaaattttgagcccactcactgatgttaccgcagttgag
ggcaccaaggctgttattgagactaaaatctctgctgctgatgttacctctgtgaaatgg
ttacacaatgacaagcttgtgatgcccagcgagagaatccagatgcttgcaaagggatcc
aaacagcacctggtattccacaggacctttgccactgatgaaggaacctacaagctatgt
gttggcaaagctgactctagctgtaaactgactattgaaaaaattcatatcttgaagcat
atggaggatcaagtttgcactgagacccagaatataacatttaaagtcgaggtttcccac
cctggcattgccgctgtgtggacattcaagaaacaagaactcaaagctggtccaaagcac
aagattgaggccaagggcaagaattacagtatgactgtcattaacaccatgaaggatgaa
gaggggcaatacacattcgctgctggtgaacaaacatccagtgctaagattactgtgtca
ggtggtgccataaacagaccactccaggacgtgactgtggctgagtctcagacagctgag
ctggagtgtgacgtggccaacccaactgctgagggcaagtggctgaaggatggacaacct
gtggacttcagtgacaatgtcaaacatgtgaaaaatggagctgtcagacgtcttgttatt
accataactagaccccaggacatcggtgaatacacttaccaggttgcaaactccaagaca
acagccatcctgagggttgagtctgtgaaagtcaagaaaaccctgacgaaccaaactgtc
actgagacacaggaggcagagttcagtctcgagctcagccacaagaatgtgaaggactca
caatggattaagaatggtgtagagatccaacctagtgagaaatatgaagtcaccgttgat
ggcatggtccacaccttgaagatcaagaactgcgacacacgtgatgaatcagtttatgga
ttcaaacttggaaaactatctgctaatgccagattgaacgttgagacaattaaaattgtt
aagaagcctaaagatgtgacatcactattggatgccactgcctcttttgagctgagcctg
tctcatgatgacatccctatcaaatggatgttcaataacgttgagcttaaaccaagtgaa
aacatcaaaatgctgtctgagagaaaagctcacaagctgatcatccagaatgtgaagact
aacaaccatggagagtacactgctgtagttggaaacctgcaatgcagtgcatctttacat
gttgaagctctgcgtgtcacaaaacccatcaagaacattgaagtcccagagacccaggtg
gccacttttgaatgcgaagtgtcacatttcaatgtcccatccacctggctgaagaatgga
gtggagattgaaatgagtgacaagttcaggattgtggtgcagggcaaacttcaccagctc
aagatcatgaacactggcagtgaagactctgcagaatacacctttgtctgtggaaatgac
agagtctttgccactttgactatcaatgccattttgatcacctccatgctgaaagatctc
agtgcacaggagaaagacaccatcacatttgaagtgaatgtcaactatgagggcatcacc
tacaagtggctgaagaatggtgttgagattcgctccactgacagatgccagacccgcacc
aaacagctaactcactctctcaccatccgaaatgttcattttggtgatggtgcagagtac
aaatttgtggctggttctgctgcgtcatcagcaaagctttatgttgatgctcgcattatt
gaattcaccaagcatatcaaagatatcaagatcacagagaagaagagggccacttttgaa
tgtgagatctctgagcctaatgttcaggtgacgtggatgaaagatggacaggaactggac
atttccgaaagatacactgtatccactgaggaattcctgcaccgtctaatgatccagtca
gtctgcatgtctgatgccggagggtactctgtaatcgctggtgcaagcatgtcaaaggct
catctcaccgtggagggcaaagatgtctgcattacagaacctgctgagaagaaaatgacg
gttgttgagaaacaaagaacaacgttcgagtttgaagtcaataaggatgacattgaaggt
cgctggctgaggaacggcattgagctccagttttccgttgaccagaggttcagctatgca
tgcattagaaagctccatcgtctgaccattactgagacctgcagaagtgatgcaggagaa
tacaccttcatcgccggcaggaacaggagggtggtgacacttcatgtcaacatccctgag
ccacctcagatcattaaccacatgcagcccctgtctgtggagtccggcaaacctgctcgc
ttctctgtggaagtgactggcgtcccccagccccaggtgttctggtacaagaactcccag
gctctctcccctggcttcaagtgcaagttcctgcgtgatgggaatgaacactgtctgctg
ctcattgaagtgttcccagaggacgcagcggtttacaattgtgaggtcaagaatgagggt
ggtgttgccaccagttcagctgcactgaatgtcgaagtctcagaagtagtttctcctgat
actggagctcctctgtccccacctaccattgtctcaccaatcagcaacacctcaaccact
gagggagagtcagccagattccagtgcaaagtttctggagaagctctaaagatatcctgg
ttccgtggtgagaaagaaatgaagcagtcaaacttctttaagatgtctacgtttgataac
acctgccagctggagatcaccagagtgtgctctgaggttgagggggaatacacctgtgtt
gccagaaacccagcaggaatggtcacatgctctgcacatttgaaacttgatgggcaaaaa
ctaattacggatattacatccgattctcaaaagcatgtctcatccagtatttcaacaagc
ttgtcaagtgtaaagaaggagcaaattgcccaaaggcccacttttattcacccaatagaa
atctgcatggttcagcatggtgaagtggccaggtttcatgcttgtgtatccagcatgcca
aagccagagattagctggtatcataaccagcagccaattaagcctactaaagatattgtt
tttcattctgatgagatgacaaacaccaccacactaattatagttgctgctttctctgag
catgctagacaaaacacttgcaaagcaaccaataatgctggagaggcggtgtgcacagca
gcccttgcagtaaccaaagaagaagtaaccaatatgaaggaagagattgaagcaaccatt
gagcaagaagtcaaagagttttataataaaaggactgtgtttcgggagaacagagggcag
atgcgcggagccttttcagacacggaggaggtcttggatcaagccaacaattcatccatc
aagccatcttttaaaaaaaggctgaagttccagaatgttttagagggggaacctgctgtg
tttagatgcagattggtagctttcccaaccccaaccataatatggtttcataacaataga
caaattcataaagaacgccgtcggagaatacgtacagagagcactttgcacatgcatgaa
actagtttagtcattgatagtataaaagacaaagactccggcagttacaaagtaatggtt
attaacacagaggggtctgcagagtccatatcatcacttctggtgtcaatgagggaagca
caagaaggcaatgatctaagtcacattagacggtcaactagacttcacggaagcctagac
tcgttggttgatcaaaaaaaggagagaaaatgcagggttaacttgagatgtgttgggtct
ccatttgatcaaaagttcaaacctagcggcagatctagatctaaggatgcaccggttcgc
accttgcacttcagaagttcatcaccaacaagagggaaagataaagaaactaatctgaat
gaaacagcatccgaacgagccctctctccaccttctatatttggtggagaaagagttact
aggtctgaaaggtttaacgacagatacattgatatctactgtgacagacacactggcaga
ttcagcgacaagttcagtgacaggtgcagtgatagattcagtgacacagaaagcctccac
gaagaggtaaaagccaagcttggcctgttacaaaatgcagtcaaacgaaaaaagaggctc
tctatgtctacgctgtcatcatcagagtttgacttggagtcaaacgcgagtgaaaccagc
tatgcagattatgttgatcgattaagggtcaagaagcctgcctccttacctggagacttg
cagcatgctcgaccttttgaaagaaacgttagaaacgataaagtgtctgccgaattctat
ggtagatatgacagaattcccacacattgtgctgagtcaacacagccccgcgtgagacat
tcatttgaacctcagtctcgaactagggccattcaaatgttaaaaggtgatctaccagcg
acaggaaatgaaaaaaactttgatgaaggagtctctgaaacacatatggataaaacggtc
cttactccaggggaacctcaacatgagttaggattcgaacataagataggtaaggattta
gaaaatcaaggtgcacaatacataggaaatcaaggtgaggactatttaggaaagaagttg
tctgaagacttgaagacaaagatggagggaccgtttgtctttgcttgtcctgaaacaagg
agatctctaaacattgctgaaaaggatgaattttccagaaccagctcaaacaaaccactg
aaggaaatattttccagtaagacgactaatatacaagaggatactgtgaagagcactgaa
gaacaatttgaaaaacaacccagctttgcagaaaaccggtatgagaacactgagagtgaa
tgtgaagataaacttttagccttgcggattagaaaatggcaaaaaggaatgcagatggac
caagaggaacagtttaagcatgaaacagaccattcaaaggcaagggatttgccatacacg
caatccaaaatattatatggtgaggaggtagagagaaaaacagacacaaaaactgtcagt
gtcaatgaggagaaatcttgggaagagcatcatccatccctggaaaaggtctgcttaacc
cgggaaaatgtgtacggattaaagagtggaactgaacagaatttgtccctttcccaaacc
aaagacgagagtgcctgtgagaagaaaacaggagaagagaacactgtatcacaagaaaaa
atccatgaattgaatttgtcccattctccaaaagagaggcatgtcaatatgtatggtgag
gaggtagatagaaaaactgcaacagaaactgaggcattaaatttccaacatttgcccagt
tctcagaaaaagagtcctgcagaaagtagtgaggtaacatgggaagaggaccatttatcc
ctgaaaaaggtcagtttatccctgaaaaatattgcccctttccagaatgtttcactttcc
caatcaaaagagaggagcgccaatgagaagaaaacaggagaagagcaccatttatcccag
gaaaatatttatggaatgaagagtgaacctgaacagaatttgtccctttccccaagagaa
atgcgtgctagtgagaagaaacaccaagaagagcagtgtcttttatcccgggaaaagacc
cacaaaagtgaaatgtttgggagtgaggaagaggctctgggacatcgaatcattaaatgg
cagcaagacgtcttgactgagcaagggtttgctgttgacttggattctgattgggttggt
gcagagtactcaccatatatcgctagaaaagtggctgagtcaaaaatggctgctgaaggc
attactcttggatcaaccgctcactctgaggcagattcaacgagaagaagaaagccttcc
ccagaaaagacagactatgaaaagttactgactgaggatgttcctcatggtttcagagat
gagagaaggtcctcactagaaaagactgtaaaggaacatgtccttactgagaatgatatc
cctcctgaatacagatatgacaggtcttcaccagaaaaaaaaacgaatgaaaagttcctt
actgaggatacccctcatgaatacagagatgtaagaagaaagtcttctccagaaaagaca
acaaaggaaatgcttctccgtgatgctagagcccatgaaggtccaagaaggccttctaca
gaaaagacatcaaaggaaaggtttctgagtgagcatgcccctcatgactacagagatgaa
agaagaagatcttcgccagaaaggacggcaaaagaaaagtccctgagtaaggatgtccat
catgatttcagagatgaaagtttccaatggccccctcctccacaaaccgttgtagatgaa
acaaggatgcagacaacagaaagtgagtattttgtgagcgaagaggaagctttggctcag
cgcatcttaaaatggcaagaagacgttctcaccgaacaagaagaagctgttgaattagag
tctaactgggctttggctgaacattcacaacactcaaagaaaagcgatgccagtggacct
catgaaggttcctctaatgaacctgtgaaagaacgctcacctgtgaaagaaccctcactt
atgagacaacatcacattggtcagtatgaaagttcctcttttgaaccagtctctcatcag
aatgagaagtctcgtacaatgtctcttgggttctcgcatgtgaaagagcactctcctgtg
aaagaatattcacctatgagacaacatcggattggtgagcatgtctctcaagaggattgg
gctatggctgaacatcgtaggagaactgatgtcagtggagatgatgccaatgaaggtcct
tcttatgaacctgtttctcatcatatcgagaagtttcatcaaatgtcacttgggtctcac
tcacctgtgagagggtcctcatcagttagagaaacctcacctggtagagagccctcccct
ggcagagaacgctcacatgacagaggtcaatcacctgtgaaagaacctggtagagaagcc
tcatctgggagatgctgttcacctttgagagaacttcacattggtcagcatggctctcaa
gctgaagttggtgcggaagggccttccaattgggaatctgacttgagacacaatgaaaat
gtggctattaggactgcagagaggaaagaaggacatagagaaatgctatcaaaagaaaac
cttcaccaaatagacatgcctcagaggactaaagaagttaagacttcaccaaaaacttct
gtacctatctttgtgagagaaatctcatccttgaaagtaaagaggggagagatgacagac
tttaaatgtagttttcggggagaccctcaaccaattgtcacttggctcaaagatgaccaa
ccaatcggtcaaaacccagactttgatgttctcaccaaattgaacgaaacaactttaact
atctactatcccactatataccatgaagggacatttagttgtgttataactaatacattc
ggaaagtcaacctcctctgctacactagaagttactgaaagtaagcaattaagaaaattg
ccatcgccagtggcctcgtacaaagtgaaagtgacaacagagtatgaaatgagtgaagaa
gatcttgaccaaatgattgacgatgaacttgaatcgtacaatggtgttgaaatggatgag
aaatctttactacaggtgccacaggctgtcttgcacagaccttgtgcttcagacacttca
caatattcttgttctcctgtcgagatcaggatcactgctccaacaccagtcccattcgaa
atgattggaaaagacacagagatgtctgaggacgatggcagttcccatcctatgaaacac
aaattcacattctgctatgatgccgcgcaggtagtaagtgaatctgagaagataagttct
tcagaaggccaaaccggaaaggttgaaatcagatctgatgtgtccttccaatctgctgtg
actattgctagatcttctgaggtagaagcaaccatggctggtgaatgggaacaacatata
ctatctggaaattctgaagatttgaggcagtcccctctgagtgatactgggcatatttct
gacccgacattgatgcagactttgaacaaatctgtaggttccaacaaccctaaggataat
gtttcagaattagctagatcagaggcagacatggcaaatgagagcaaacagcatatacta
tccagattttctgaagatttgaggcattcccctctcagccatactagtgatattactgat
caggcattaatgcaggagctggacaactctataggttcccacagccctgaagagtatgtt
tcaaacgtatctaaaccaaaacaaagtgtttcaaaagaagcacctactattactgggtgt
ggtctgcaatcatctgctgcgccagtcaaagtgtcacaaatgaagcaggcatttgaggca
cctgggttgtcagaggcacctgacttgttagataccacttctgttgatgaagtgaaaaag
tccacagagtcatatttccctgaggagtatatcccagaagttgcaatccatcttgatcat
gatgataagtcattggcaactaatgttgtggaaggaactccactgcagtccaaacaaaac
agtatgttagtagaaggtagtgatacacagattccgagagcaaagttaatttcagccaaa
agtgggccagaggttgtgttactaggtggtgcacagatttctgccaaagtgaaatcagtc
tcccccaaatgtgccccagtgggtgtccaggccatgtctgatactctggaggaagacaat
gaaatctgtatgatttctggagaaactgttgaggaagctgacataattgacacccacagt
cacttaagtataagagaggtgcaggtgtcaccaacgcttgtcagacctgaggcagttaag
gcagtaaagactagccattcaacagaatgtatgggacctcatgtaaaagatcaaaatatg
atagaggacagtctttgtgaaaaagtcccagtgttggtgaccccagatgatgtttcagcg
tcagtctgtgatgagtctgtagagctaaaaagattatctggctcatttgcagctccagaa
attcatagattggacactcagtcttctgttggcaatgacatgactgatattaatgaaaac
ttgtctctatctgaactcttaaaggatagcgcgtttgtcagtgttacttgggcacatagt
gaaattgttagtgaagaaacagcagaggaaaacgaggaacatgctgttgctgagagtggt
gagccttcagtggtttcaaaatcaattaacgtcaagctcaaaggagatgggtgtacagat
tatcttgctgcacaaggtccacaacatcaagcagaggctaaaccggaaagtgctgatcta
agtacggctgtcagtgaaggtgcttcaggtgtgatctcacttgaggaggaggtagtaacc
ttcagtactgtttatgactactaccacccaccaactgaatggggcagacccttatcacca
gagtcagatatgtccattgagtgtggtagcacatttagtgaggaattaacagaaatcgag
cagttctatactccagattcttcaaatgaaaatttgcagctccctaaaactccagaatct
ttccacactcctgaaactgaaaccccggcaggttatatgacccctaatgagtatgccttc
tctcctcttgaacgtaaaagaccatccactgactccagtgagaggttattttctcctgct
aagttcttgaggtcacccgatgatgagggcattgagacaacaccccctgcatttagatta
gatgaaggacgtttcctctcagagcgtgcccttggccttggaggactacaggaaaaagtc
cagggaatccctccggctttcctcaaacctctcaccaaaaggagagtttttgaacatgat
tcgttatcgttttatgctgagttgtttgggttgccttcacctgaagtgaagtggtttaga
aacaaaacccaatttgttgcagatgaaaggattacaatggacagagatggtgacaatatc
tggcttgttattcagaacattacgaaagctgatcaaggtgaatatatttgcgaagctgtt
aactatgtaggagaggcaaaaagcgttgcactagttgtagttatatccaacgaggccaga
taratgcrcccaccaccymcagtcacccarcagcatgtgatggagtttgatgttgaggaa
gatgatgactcatcgaggtcttgctcccctcaggagattrtattygaggtggagrtggat
gaaaatgaggttaaagagtttgagagacaggtgaagataattaccytcccagaatacacc
gctgacaataaaagtatgataatatcactcgatgttctrccgagtatgtwcgaggagagt
ggagttgactttgtaacgcaagaaagggatgatttgaaaatagcttttgaggttacagaa
atgccgcctcgcttcatcaacccaatttgtgatatggaaacccctgagaatacaactgta
atgtttgagtgttctctgatgggaattccatcacccatagtatcatggtttaaaggtaac
aaaaagatccctcacgataacaagaaatacttgtactcatctgatggagacaatcatttt
cttaagattaggaacgtcagcgctcatgatagtggaatatacacctgcagggccatcaat
gtggttggggaaactctttgccgggcatctcttcttgtgttgaatcctaaaagctttata
ggaaaaacaagagggagagaattgacagctgtgtctcttggtagtgctaaagttcagcct
caaaagtttgacttggttgttgggactgaatttgacggtgagcaggcatcagaaatagag
ctggaatttgaatttgagcaggaagctgatgaatcacaaaaggctgttagacttgtagcc
atgacgaacaatgagatgagcgagcagggacagaaatatgtcagtatcaactttggcgtt
ttcgcagagcccgccaaagatgataaaatagttttcaaaggaaagtcatcagaattgtgt
agtttccggtttcaaatgactgaaactccaccaaaatgcattattcctttgacaaacatc
actgcagcagtaggaactccagtggtcctccagtgtttagtgaatggtaagcctcatccc
accgctgaatggtacaaagatggcgatccagtgaaagacactcggtacatgatccaagag
aaagcatctggacattttaatttgatcatcacaaatgtcacccaaaaggatgccggagag
tacaagtgtcttatccaaaacaaatctggatatactgaaacaactggtttgttgaacgtg
ttgaacaacccagatggctctggcttcatcagcatgaagggcatccaacagcaggacagt
ggtctctacacatgttataaagtatccatgtcagctgaacaagctacagagtcccacttg
tacgaggtcaaacttcctggagaggccagggccagcattcaggcaggacatcagatggtg
tacaccattggcacagaggacagccacgttgtaaaaacccttagagagttggataactca
gcggctacgttccaaaaagagaaggtcacccatcaggctgcagttctgcagtcacatgag
cttgagtctacgaaactagtggtgaaaggaagtgctgtgaagctggagtgtaaagcaacc
ggcacccctgagatcatttttaagtggtttaagaacgagattgagatgagacaaaatgag
aaatacaaaatggctgttaccaactcagttgcctcactggagattgccaactgctctgtt
gatgatagtggagattatattaattgcaaaatatctggatctcttcctatcactgtggaa
tggcagaaagatgggaacagaattgacgttggtggaaaatataaacttgttcgtcaagac
atttctatgtctttggaaatcagacagttagagagagctgatgccggcacttactcttgc
aaactgacaaataaagcaggaagtgttgaatgcagtggggcagtggtgaaagcgccacca
agctttgtgctgttgcctgagtctcatacagcccttcctaactccaacatgtgatttaag
agcacgtttaaaggaacacctcctttcacagtgaaatggtttaaggatgacactgaattg
atcactggaccatcatgttttaccggactggaaggattatcttgcttcttagatctttac
tcagttggagttttgcaaagtggaatttactcttgtcaatttaaaaattatgctggcatt
gaaagatgtagtgccgctttaatggtgaaagaacctcctgaatttgtgctaaaattgcca
gtcacaaagtttgtgaagaagtgcgagccactccatcttgaatgcaaagttaagggtgcg
ccctctctgcgaatgcagtggtacaaaaatgacactaagatcacagatggtgacaactat
agaatatcatttgttgactcaatggcagtccttgagctgcgcaccacaagatttgatgac
aatggagtctacacctgtgaagcaaccaatgacgctggaagtataagctgcagcacaact
cttagagtcaaagacgcaccatctttcctcaaagtacttcggccaattgaaggaatgaaa
ggaaaggatgctagcctacactgtgagatgtttggcacagcaccctttgagattacctgg
gccaaatacaaaacgccactaaaggaaagtaggaaatataagattgtgaatgaggttacc
gctgccactcttcatataattggattggaagcttcatattttggagaatataagtgcaag
gcaccaaacagtataggatatgaaacatgccgtaccacagttaaactcagagaaccacca
acgtttgtggagaaattgttgaatacgacatgcacattgggtgaagaagtcaccctgaca
gccactgtcaaaggctctcagccaatgactgcatcttggatacaggataaggatcacatt
ctcagagatggtgacatccagaaaattacctttgaaaacaaccaggtccctcttaaagtc
tttaaagcagactcactggtaatgggcaaatacacgtgccaactccgaaacgatgccgga
gttgtggaatgtttttctaacataactgtattagaacccgctaaggttgtggagagacca
gagtctttcagcgtgactgcaggtgatattgcagctctagaagtcaaagtgtcggggaca
ccagagctgaaaccaaaatggtttaaggatggagtcgagctttcctctggccagaagtac
aacatctccttctcaaagatgatctccagcttgaaagtgttgtctgcagagaggattgat
atgggagaatatacatttgaggtcaaaaatgaggttggcagtgatctcaccaaattaaac
ctcactgtcctagataaaaccatacctccaacattcacacggaaactgaaggaatctcaa
cctattgttggaaaagctggagaaatggactgcaaagtctctggttctgcacctttcacc
attacctggtaccatgatgaagaggagatcaaaactggaccaaattatgagattgcattc
agtgacaacacctgcacacttaaagtgcccactcttaagtggtctgactctggagtgtat
aaatgcaaagccgtaaacaaggccggaaccaatgagaccagtgcctctttcattgtgaaa
gaacctccttcttttgtgatgccacctcagccattggaagcaatgcctggcacaaatgta
actttctcagcaattgtcaaaggaagtgccccactgaaactgaaatggttcagaggcaca
aaggaaattgtgtctggaaaaggctgtgaaattgctctacgggacaatacagctactctg
gagctatccaaaattgacaaattccacgctggagagtatacatgccagattattaatgat
gctgggatggaaagtttcctagttaacctgtctgtgaaagaacctgctagctttgttaag
aagctgaacgaccactctgttgaaaagggaaaatcattgatacttgagtgcacatacact
ggaaccccaaagatatttgtcacctggtataaggacggcaaacagctatatgcctcttat
aagcaccacgtcactaccacagagacctcctgcatcttggagtgtttaaacagtgacgat
aaggaagcaagtggggaatacgcttgtgaagtttccaatgatgctggaaaggatacctgc
aaagcacaagtgttcattttagaaccacctcatttcattgatcatttggagccaatggaa
gttactgctggtgatgcagtttgtttgaaatgccatgttggaggaacccctgaaattaag
gtggcttggtttaaggccgacggaaaagtgaggtcctcccctaattgcaaaatagagtat
tccaaaggcattgcttgcttgaaattgagcaaagcagccgaggctgatattggtgaatac
acatgcaaagctgaaaacagaataggatcagcctcatccagctgtcgtctctctgtccaa
gaggcaaaaacgccacctaccttccccaagaaaataaccagcattcaacagactgaagga
aaggaagttaaatttgagtgccgtgtggcaggctcctcgcccattgaggtctcttggctt
aaagacggtgaaactgtgaaatccaacgactataccatgagttatgatgataacactgct
gtcctacaaatatccagaggtgaaatgagacactctggggaatacacttgtgttgctacc
aacagtgttgggactgcatcctgcagagccaaactcactcttaaagagccaagatatccc
cctgtctttgataaaaagctgtcacccgtggtggacgtttcagtgggtgatagtgtggaa
ttggaatgccacatgactggatctttgccattaaaagtcacttggtcaaaagatcacaaa
gatattcgatcagggggaaattacaagatgtcctgtgtggataacaccccacacctcact
atattgaaagcagatacatcaaattatggctgctacttttgccatgccactaatgacatt
ggaaaggactcttgttccactgaaattactgtcaaagagcgcaaaatcccaccttcattc
accaaaaagcccacagagaccctagaggaaacggagggcaagatggtgaaaattgaggca
cgtttgtctggatctcagcccatgaccattaattggtataaagatgacagtgagattcac
agctctgatcactatgacatgtctttcaagagcaacgtggctgtgttgtgtatcaagagc
tccaaagtctcagactgtgggaggtataccggcacagccaccaatgaagcaggcactgcc
tcttgcaaattgacagttaccataactgaacacaagaagccccctacatttgaccccgct
ctcaaacctgtcacgctgaccgagggtgagaacctgcaccttagctgccatgtccatgga
tccccttctatgacgattcagtggatgaaggacaggaaagacttgaaaaacaagtccagc
agtaaaataagttttgccgatggtgttgcctctttggaggtcatgcgtgtatcaaagaat
gatgcaggggactatctctgcaaggcaaccaatgaggctggtagtgaattctgcaaggcc
aaagtaactatcaaaggtacaccagagaaatccaaagcagcacctgaacccgctgaagag
gaaccaacagcagcaccagtaaagaaactggacaacttgttcttcatcgaggagcccaag
ccttgccatgtagccgagaagggcactgcaactttcattgccaaagttggaggtgatcct
attcctaatgtgaaatggatgaagggcaagtggaggcagatcactcatggtggacgcatc
actattgagcagaagggacaggaggccaagttggagatcacagaagtaacaaagtctgac
tccggacagtacagatgtgtcgcaactaacaaagctggagaaatagaatgcagcaccgac
ttgaatgttgacgaaaggaaagaggatgctggagttgagggagacttcagagcaaaactg
aagaagactccatctaaacagaagagtcctcgggaagagaaagacattgacattgtagag
ttgctcagaaatgtggaccctaaggagtatgagaaatacgcccgtatgtatggaatcact
gactaccgtggacttcttcaggccattgagcagctgaagagggagaaagcagaaggaagt
ggaagaccggaaccggagagagagagagagttggatgaggatttggtcgctcttgtggct
gatttgcaaaagagaatggaatgtactgagccggtcaccgtgaataaggacataacagat
cagtctacagtcaccaacaaggttgctacttttgagtgtgacatcaagatcaactaccct
gagatcaccctgtcctggtacaagggaactcagaagcttgacaacaatgacaaatatgaa
atcaacattgttggtgaccgtcacatcttgaagatcaagcagtgtcaaaccaaagaccag
ggaaactaccgtgttgtatgtggcccacatatctccagtgccaaactgactgttatcaat
cctgaggttgagaaacatctggaggaagttgcgggacaggagggccaaacatgtactctg
tcttgtcagttttctatccctaatgtcaaaacccaatggtttaagaatggaaagctctta
gaaatgaaacgcagatactcgtatgaggtggtcaacaacattcagaggctctcgattaaa
gacctcagaccagaagaccaaggacgttatacctgcaaatatgaaaacctcgaatcaact
gcagatctcttggttgaagcccagagagtacctgttgaggaggagtctgtccagagtaag
aaggttggaatgagggaggaaatgccacaaaaagtgtctgaagctcacaagaaaccagag
gagaagcctaaaccagctgaggcagcagaaccacataaagaaccagcaatgaagaaggaa
tcacctccacagcctgttgaaccacttacaaagaaagtgtctcagctagagaagactgtt
gttgctgaaggggtgaaagaatctgagccatttgcaaagaaagtggctaaaccagagtct
aaacctgaaatcaagctagagtccaagccagagaagagggttattgctgaaaagcctgct
gagacacttgtaaagaaagtgtttacgccagagtctaagccagagcctaaaccagaggct
aaaacagagcctaaacctaaaccagaggttaaaccagatcctatgccagagcctgctgag
acttgtaaagaaagtgactacgccgagaagacagttattgctgatgtggtgaaagaatca
cctccaaagcctgctgagacacttgtaaagaaagtgactacgccagagaagacagttatt
gctgatgtggtggaagaatcacctccaaagcctgctgagacacttgcaaagaaagtagcc
aaaccagagtctaagccagagaccaatacaaagaagatggctatagtaccagtaaagaag
aaggaaacactcccacagcccactgagccgcttgtgaagaaagtgcctaagctagagaaa
acagctgtttctgaggaggtgaaagtaacacttccaaagccggcagagccacttgtaaag
agagtgtcttcgccagagtctaaaccagaaaaaatgaatgctgaggaggtgaaagaatca
cctcttaagccggctgagccaattcctaaaaaagtgcctaagccagagacaatggttatt
gctgagctggaatcaccacctaagcctactaagccacttgtaaagaaagtggctgagcca
gagactaagccagagaagatagctattcttgaagaagatgttcccaaaaaagttccagca
aaggagaaggaatcagctccaaagcctgctgagcctcttgcaaagaaagtgcccaagcca
gagaaaacagctattgctgaagaggtgaaggagtcaccttcaaagcctgctgagacactt
cttaagaaattgtcttcgccagagtctaaacctgaacctaagtctgagcctaagccagag
aagaaggctgttgctgagcctccaaagccagcagagccacttctaaagaaagtgtctaag
cctgagtctaaaccagagaagaatgctgttgctgagcctccaaagccagcagagccactt
ctaaagaaattgtctaagccagagtctaaacctgagcctaagtctgagtctaaaccagaa
aagaaggctcttgctgaagtggtgtctctttcaagtgaagattatgttgctcccccaaaa
gctgtgaccgttgagccagagaaggacaaagacaaagaatctgtggttttcaagagagtt
caaaagaaatcaccacaagagaaaagtgatggagcaccaccaaagaaggtgccaggaatg
aaagagctttctcccaaagcggtacagttacgaaagatctccactcagctggaggaggaa
gtctttgaggaggagccagaggttgaggaggaatctgacaatgaaggttggggatggaaa
cttgtccctcgtgatagttctgggtccacagaagactggggagaggaaggtgatgcactt
gagacccctggaatgccaagacgagatggaaagccagcagaagaagcaggtgcaggtaga
ggtgcaggcagaggcagaggcctcaaagcaggcaaaactccatcccctggtgaaggcagg
ggtagaggactgaaacccggtggtggtggaggagacaaacccccagatgctaatcctttt
ggattccagctcaaagcagttccactgaagtttacgaaaccactcaaagacatagtgtta
caagaaggtgatgctgttggtgcatctgctacgtttgagtgtgaagtttcaccttctact
gctgtaactacatggatgaaagatggcagcaacctaagagagagtccaaaacacaaattc
acctctgatggcaaagatcgcagactggccattattgacgtccaactggtggacactgga
gagtacacttgtgttgccaagctgggcaacaaggaaaagacaacaaccgccaaactcatt
gttgaagaactgcccgtgaagtgggtgaaagagctgggtgaggagacgtcggtcctgaag
gggcagcctatgtacctgacctgtgagttgaacaaggagagagaagtgacctggatgaag
agtggtaaagtcctcaaagtaatcgctggaaaggtggccatcaacgttattggaatgcaa
caagccgttacaatccagaacatgggagatgacgacgctggaatctacgcatgcgagtgt
gaactcatcaggactaaaacaactgtcaaaatcattgaaattgtcagagactggttggtg
aaaccattgaaagatcagcatgtgaaacccaaggccactgccactttcaaatgtgagctc
ttcaaagaaacccccaactggaagtttttcaaaggcaacgatgagattcctaatgatcct
actgacaagactgaggtcaagaaagaaggcaaagtcctgactctcacaataaagaatgca
cagcccgaagatattgcagaatataccatggaggttgaaggccacagatacacagctaac
ctgactcttggagaacgtgaagctgagatcttgaaacctctctcaagttgcgaggtggtc
gagaaagaggatgttacatttgaaactgagatatctgaagaggatgtgcctggagaatgg
aaacataaagggcaggtcttaacaagatcaccgacatgtgagatcaaaatggagggcaat
aaacgtttcctcactctgaaaagtgttccactggacgcgtctggtgaagtgtcttataca
gctctgaatgctgtcactagtgctgtgctcacagtcaaggagatggaaatggacttcaca
gtccccttaaacggcatgtctgtacctgaaaagaaacaggctatgtttgaatgtactatc
acaagggatgtgcctgaagtcatgtggttaaaggggtcagacactattggtacatcagac
aaaaaatatgaaataatcaatgatggaataatacatatgttggtcataactcacaatggt
gagtttgatgatgagggaaattacagtatagaagccttgggcaaaaattcaacctctaca
ctcactgtggagggtatgaggctcaaatttgaattgcgacttcaggaccaaactgagaag
gaaggtaacactgctcggtttgagcttgagctctctcatgagaatgtacctgtgacatgg
tacaaaaatgaagtagaactccatgtgagcagaaccgtgctcatccatagtcgtggaaag
aaacacgcgttagaaatcaaggagttgactcttgatgatatctgccaggttaaggcagag
gctaaaggaattctctcaatggcaaaactgacagtgatagagggggatgcatacttcgta
gtgaggttgcaggattatactgcagtcgagaaangtgaactcagcaaagatgtcccagtc
atgtggtaccataatgagactgaaatgaaggcctctaagatggtaaccataagggctgaa
gcgaattgaagaatgttgtccatcaagaaagtggaggactgagataagggacaatacgta
tgtgattgtggaacggacaaaaccatggcaaatattaacattgaagctcgagatatagac
ataactcgcccaatgtatgacgttgagctctttgaaggcaagactgctcattttgaggta
gaaatctctgaagatgatgtccatggccagtggaaactgaactgagaagtccttactcaa
tcccctgacattgaaacgatagaggacggtgcaaagcacacattaatattatacaacctc
aaggcccccttgtcaggggagattctatttacagctgctaatgctaaatgtgttgctaat
ctgaaagtgaaagagagtccaattacatttgtcacacctttgagtgatgtacaagtgtat
gaaaaatatgaggtcagatttgagtgtgaggtgtccagagtgcctaagggcttccgttgg
ctcaggagatctcatgagttgacagctgatgataagtttgatattacccatgagggaaag
agacacactctggtggtcaaatctgccgcatatgaggatgaagctgagtacatatttgag
gcagagggcaagagaaccactggcgaactagttatccaatgaattcgccttgagtttgtg
aagcccattaaagatgtcatggtcaaagagcgctagacagcagagttcagtattgaggct
agacagcagagttcagtatcacatgacaacatccaggtcacctggtacaagaacaatgtg
cgtttgcatcccagccaagttgtgcacatgtcagacgatggcaagatgcacaaattgacc
ttcaagggggtgtccattgatgacacatccatgatcaaagtagaggccatggacaaaatc
tcagaggccatgcacacagttctcgagggaaagccttacttcacgacaaaactgcacgac
tactcagtcactgagaaagatgaactgacgatgatttgtgaactgagcaagcccaatgca
gaggtgaaatggttcaaaggtgaccagcaaatcacttcctccaagaacgtggtcatcaaa
gctgatggaaagaggcgtatgctgatcattaagaagacagagaaagccgacattggagaa
tacagctgtgattgtgatacggacagaaccacggccaagctcaacattgaagatcgtgac
attacgtttgtcaggcccctgtacagcgtggaagtgacagaaactgaaatcgccaagttt
gagactgagatctctgacgaggatgtccatggtcactggaagctcaatggagaggccctt
catcagtctcctgactgtgagattaaggaggagggtacaaggcatgtccttatcctgtac
aacgttcgcaaggatcaggccggagaagttgacttccaagctgccaatgctaaatccaat
gctcagcttagagttaaagcgcgggtaatcggcctgctgcagcctctcaaggatgttact
gttactgctggggagaccgccactttcgactgtgaactgtcatatgaaggaattgctgtg
gaatggttcttagggggtacaaagttggagccaagtgacagagtggtcacccgagcagaa
gacaaaactcacacgctgactctcagagatgtcaagatttcagaagatggagaaattaaa
ctcactgcaaaggatttccagattgaggccagactacatgtgaatgaaccaccagttgag
ttcaccaaacctctggaggaccagacagttgaggaagaggccactgctatattggagtgt
gaagtctccagggataacgctgaggtcagttggttccaagatggacaggagatccgcaaa
acgaagaaatatgacattgttgccgatggccgcattagaaaactcatcattcatggctgc
actcttgatgattcaaaaacatttacctgcgacgcctcagaattcaaaacctcttgcttc
cttaacgttgaacctccacatgttgagttctctaagccactccatgatgttgaggtcaaa
gaaaaggaatctgccagatttgaatgcgaagtatcgcgcgaaaatgccaaggtccgttgg
ttgaaggacagcagtgaaatcagaaagggaaagaaatatgaaataatcgccaaaggtcgc
caacacatcctcatcatccacaaatcagtgttcgatgatgaagcagaatatgaatgtgat
gcgaaggtctccaaatcctccggcctgcttacagtcgtcgaggaagaagctacgttcacc
aggaacctgtctaacgtggagggaacagaagcagacagtgtgaagatgatttgtgaagtg
tcgaaggcagacgctgatgtcatgtggtataaggaagaccaggaacttcccgagggagga
agatacgatcagatcgtagacggcaggaagaggatacttatcatccaggatctcaaaaca
gatgatgctggagagtactattgcaaattgtccagctcacagacaactggaaacctgaaa
ataaatgaattggctgctgagtttatcgccatgcctcagagtcaggaggtggttgaggga
gaaaaggctgagtttgtatgctcagtctctaaagacacattcattgtcaaatggatgaag
gatgataaggagctagaaaaaggggacaagtatgacattgtctgtgatggcaagagaaga
atacttgttatcaagaactctgaacccaaggatgagggcgcctatgttgccctcattggc
accaccagagctacagctgatctgtttgttcttgaaaaactcaggatcaacacaccaatc
aaagacacagaagccaaagagggacaggagatcatcttcaactgtgaggtgaacactgag
ggagctaaagctaagtggctgaagaatgaggagaccatgtttgagagcagcaagtttgtc
atgatccagaaagacaacgtgttctctctgaggatcaaggatgctgagaagtcagatgaa
ggaaactatactgttacattgacaaaccaacgtggtgaacatgccaagagctctggcaaa
cttacagtaaaagaggagagtctgaagatcattgtacctcttgaggactgcgacacacag
gagaagaagactgttagcttttcttgcaaggtcaacaggcagaaggttactctgaaatgg
acaaaggctggtcaggagatcaccttcagcaaacgcataatctacaggttggaccaatat
aagcacacactgaccatcaaggactgtactcttgctgatgaaggtgaatacaccgccatc
gctggtgatgacaagtctacagctgagctgatcattagtgaagcccccactgacttctcc
gcacaactcaaagaccagaccatccccgagtttgagaatgctgagttcacctgcaaactc
accaaggagaaggctgaggtgaaatggtacaggaatggacgtgaaataagagagggaccc
aggtacgtctttgaaaaagagggcaagacctgcaggctgcgtatcaacgagtgcagacca
gatgatgagtgtgaatattcctgtggcgtagatgaaaagagatcacacgcccatctcttc
gttgaagagagtgcagttgagatcgtcagaccaccaaaggatgtgtttgagcctccaggc
tcagatgttgtatatgaagttgaactgaacaaagacagagttgaggtaaaatggttgagg
aacaacatgaccatcgtccagggtgacaagtaccagatgatgagcgagggcaaggtccac
agactccaggtatgtgagatcaggcctcgggaccaaggagagtacagaatcatcgccaaa
gacaaggatgccagagccaaattggaactggctgctaagccaaatatcaagactatggat
cagagcttagtaacagatgctggaaagcccatcgtcatgttcgtgccctacagcgcgtat
cctaaagctgaagctgagtggttctatgataatgtcagcctacccaaggacaacatccac
actgttggagacaggacagagtacaggctgaaggaccctaagaagtccgaccaaggacgt
tacaaggttgtcatcaagaacaaacatggacagggagaggcattcattaatctggatgtc
attgatgtccctggacctgtgaagagtcttcaagtgcttgacaccgccgatggtgaggtc
agtctggcctgggaagagccagagagcgacggtggcagcaagatcattacatacgtggtg
gagaggcgtgacgtcaagcgcaagacatggactcttgctactgaccgctctgacgctcca
gaatacactgtgaccggactccagagggaatccatgtacctatttcgtgtttctgctcgc
aacagagtgggcagtggaccaaatattgagacagagaaacctggtgtttatgccaagaac
aagtttgatgttcctgatgctcctcaggatgtgagtgttggaaacgtgagtaagtttgga
gccacagtctcctgggaaaaaccagtgtctgatggaggggctgagatcacctcctacata
attgagtcccgtgacaggacctctgtgaagtgggccgtggctatgatcagtaaagcaaca
gaccgcagtgcaatcatcaacgacgtcattgagaacaaggaatacatcttccgtgtcaag
gctgaaaacaaggctggcattggaaagccaagcgctgctaccaatccagttaagatcatg
gaccccattgagaggccaagcccaccacagaacctggtgccctcagaacagaataagaac
tcagtccagctgacatgggagaccccattgaagaatggaggcagcatgatcactggctac
atcattgagagatgtgaggacgaaacaaaccattggctcagatgcaacgccaggctctgc
caggatctcacctacaagatatctggcctgaaatatggcaagaaatacaactacagagtg
atgtctgagaatgcagctggagtgtctgacccatccaacacactgggacccatgctggct
gatgatacacatgttggccccacaatggacctgagtggattgaaggatggccttgaggtc
attgttccccatccccttactatccgtgtccctatctctggatatcccacaccacatgca
aagtggagctttgctgataaggagctcactgctggtgaacgtgtttacataattacaaag
agtacctatgtagaactgaccgtcactccaagtgtgcgtccagacagaggtgtatacgct
ctgaccctggagaatgatattaccagttgctcaggagagattgaagtcaatgttatcgcg
tccccaagtgcacccaaagactttaaggttgccgaggtgaccagacagcatgtgcacctg
atgtgggaggcaccagagcatgatggaggaagccctctgactgggtacctgattgagaaa
cgtgacgtatcccgcaagacctgggtcaaggtgatcactggtgttcaagaccaggagttc
actgtcactgatgttgttgagggcaaagaatatctgttcagggttactgcctgcaacaag
tgtggcccaggagagcctgcctacattgacgagccagttaatgtgtcctcccctgccact
gtgccagactcacctgagaacctgaaatggagggacaagtcagcatctggcatctttctg
acctgggaaccacccaagtgggacggcggcaccggaatcaagggctacaacatagaaaga
tgccagcgtggcacagacaactgggaatcctgcggagatcaggtccctgagtttaaattg
caagtgactggtctgattgagggacagtggtatgcctaccgcgtgaaggccttgaacaga
ctgggtgccagcaaaccctgcaaggctacagatgagatattggctgttgatcctaaagac
cccccagagattcttctggatgtcaagtgtcttgctggactgaccgtcaaagctggatct
aagattgagcttccagctgatgttcttggaaaacccttacctaaagtgaaatggaccatg
ggtgatgtggtcctgaagggagatgatagagtctctattgatgacaagcctggtcactcc
gtcgttacgatcagcaagacaacgagagaggatacagctacctacatcattgaagcccac
aacagctgtggtcgtgctactgcaaccattgatgtcaacattctagataagcctggtcct
ccagctgcgtttgatatctctgagatcaccaacaagtcctgtttcctggcctggaaccct
cccagagatgatggaggtgcaaaggtcaccaactacattgtggagaggagagccgcagac
agcgaaatctggcacaagctctcctccactgtcaaagagactaactacaaggccctcaac
cttacggccttcaaggagtacatcttcagagtgttcgctgagaaccagtttggtattggt
gtgccagcggaacatatgccaatcattgccagatacgccttcgattctcccggtgcacca
accaagctggagccttctgatattgttaaagatggcctgactctgaattggtatgagccc
gaagaggatggtggtagtcctatcactggatactgggttgagaggttcgaaccagatcag
aacagatggatcagatgcaacaagatcccaatcacagacacaacatacagagtcaaagga
ctacccacaaggaagaagtataagttcagagtcatggctgagaatctcgccggacctgga
aaatcaagcaaggaaactgaccagatattggtcaaggatcctattgatcctccatgggct
cctggtaagccaagcgtaaaagacgtggcaaagacctctgccttcctgcagtggaccaag
cctgagcacgatggtggcgccaagatcgagggctacatcattgaactcctgaagagtgga
actgagcaatgggtccgtgtttcagagggaatcaatatcctggagcactttctgagaggc
ctgatggacagacaggagtactccttcagggtcattgctgtcaacatcgctggggagagt
gaacccagcgatcctagtgatccagttctgtgcaaggagagactcaatcctcctacaccc
ccacgctggatgaatgtcatcaccatcaccaggaacagtgctgagctgaagtggacagta
ccagagaaggatggtggttcacccatcaccaactacattgttgagaagagggatgtcagg
cgtaagggctggcagacagtggacaccactgtgaaggagctgaagtacactgtcactcca
ctgaatgagggctccctctatgtgttccgtgtggctgctgagaacgctgttggacccagt
gaattctgtgaactggaagactccattatggctaaagatacttatactacccctggacca
ccatataatctctctgtcaatggcgtgtcaaagagacatgttgacctggaatgggacgcc
cccaagaatgatggtggcagaccagttctgagatactccattgagaagaaggagaaactt
ggcacccgctgggtaaagtgtggtaagacctcaggggatgactgcaagtacagagtgaca
gacgtcattgaaggaaccgaggttcagttccagatccgcgctgagaatgaggccggtgct
ggacatcctagtgaaccaacagaaatcattgctattgaagatccaacaggtgcatcctct
cctccaattgagcttcatctcactgaagccagcagagaccatttgtgtattgcttggaga
ccaccagagagaactggtggcagtgctgtaactggctaccatatcgagctgtgtgaggct
ggtactgagaagtggatgagaatcaactctcgcccaatcaaggagctcaaatacaaaaca
gaggagggcatcaccccagagaaacaatatgtcctgagagtccgtgccatcaactctgtt
ggagttagtgagccatctgatatctctgagaaggtctatgccaaggaccctgactgcatc
ccaacccttgagtttcaaacaaaggacattgtgattgttgagggagagaagtggcatctc
cccatcccattcagagcagtacccaagcccaagatcacctggcacaaagacggaaaggag
ctgaaggacgatgagagaaggagcttcagacaggagtacctctcctgtcacctggagatc
gagagctgtctgcatgcagactctggccagtacaaggtcaccctggaaaactccctcgga
gctagcagcggaacaattaatgttaaagttgttggcctgcccggtccctgcaaagacatt
gttgccagtgaaatcaccaagagttcttgcaaggtttcctgggatcctcccaactatgat
ggtggcagccctgttctccactatgtgctacagcgcagagaggcaggccggaggaccttc
gtcaacatgatgtctggagagaacaaggtcagctggcctgtcaaggatctgatccccaat
ggagagtactacttccaggtcaaagctgtcaacaagattggtggtggggagtatcttgag
ctccgcaaccctgtgattgcagaggatcagaagcagagccctgaccctccattggatgtt
gagacccacaaccctacttccaagactatcaccctcacatggaagcctcctatgtatgac
gggggttgcaagattatgggctacgttctggagaagatgatgaagggtgatgagaacttc
acaagatgcaacgacttccttgtgcctgtgctgtcctacacagtgaggaatctcagggag
ggaaaacaataccagttccgtgtacgagctgagaacgctgccggagtcagcgacccatca
cacagcacaccaatggtgaaggcttctgatgctgtcgaaacacccaaggtgttcctcagt
ggaagcctgcagtccggtatgagcatcaagagaggtgctcagatcagactggacgctaac
atctctggatccccataccctcaaatcacatggtacaggaacgacgtcgtcattagacca
gaagccatgaagaagagaccagaaaaacccattgttaagaagaagaaggagggaaagaag
gaagtgaaggaaggagaaaagaaggaaggagaagtaaaggagagtgaaaagaaggaggtg
aaagatgaagaaaagaaggaagtcaaggagggagaggttgaggtcccagctactgaggcc
ccagctgcagagcctgcccatgaggagcctgaggaggaagaactccctgactacccaacc
ctccaggaacgtctcaccatccatgacaagaagaggggagaatcctcttgcattgtcagg
gacaccatcaggggtgaccacggagtgtacactatcaaggttgagaacgaccatggtatt
gcctctgcaacttgtgaagtcaatgtgctagatgcacctggacctgcaatcaacttccgg
tttgaggagatcaggaagacctctgtcatctgcaagtgggatcctcccatggatgatggt
ggcagtgagatcctgaactacaccttggaaaaaaaggacaactccaaggtggagatcgga
tggatcaccgtaacctcaacgctcaggggatgtagataccccgtgaccaaactgatagag
aagaaggagtacatcttccgggtcactgctgagaacaagtttggtcctggaccaccatgt
atttctaagccacttattgccaagaatccattcgacccaccagaggctcctgagaagcct
gagattgatggcatcacagccaactccatgctggttagctgggaggagccaaatgacatg
ggcagccccattctgggttactgggtggagcggcgtgagatcaacagcacccactggacc
agagtcaaccgggttattttggaggatacggaacttaacgtggaaggcctactggaaggt
ctgacatacatcttcagggtggctgctgagaaccaagctgggcctgggaagttcagcatc
ccgtctgatcctatgacatgccaggatccaatcttgccacctgggccaccgttcccaaga
atcattgataccactgagtcttccatcgacgtggaatgggatcctcctgcctccaacgga
ggtggagacatcctgggataccatgttgacaaaaccgtagcaggcaccaaagactggtcc
cgctccacagagagaccctggaagacccgggtcttcactgtgtatggagtcagagaggga
gccaagtacctggtccgtgtgatcgcagtcaatggagccggtgaaggaactcctggcttg
accgaatcagtcttagtcagagatcctaaagaggctccagtggtggagctggatctcact
gtgaggaacggcgtaatgatcagagctggggagccactgattctgcctgccctggtcact
ggtagacctcctccagacatcaaatggaccaaagatgacggtccaccggacaaagaccac
gtcgagatagaaaatgttggaaaggaaagcattctcagtatcaaggctgccacaagaaag
gatcctggcaaataccagatcagtgccaggaacagcagtggaatcaagtctacatggaca
agggttgaagtcatggatgttcccgggcctgtgctggacctgaagcctgtggtggtaacc
aggaagctgatgattctgaactggtccgatcctgatgacgatggcggcagtgatctgacc
ggcttcatcattgagagaagggatcccaagatgcacacatggagacagcccatcgagaca
ccctcatctaagtgtgagattgtgggtattgttgaagggcaggagtacatcttccgggtc
gtagcgaagaacaagtttggctgtggccctcccgttgatttgggtcctattgctgcagtg
gatcccaaagctccaccaacttcacctgagagattccactacactgagaggacaaagact
tccatcagccttgcctggagacctccccgcaatgaaggaggcagtccaatcttgggctac
tttgttgagaagaagaagcacgatgccccagcatttgagccttgtaacacagagatgtgc
aaggacctcttcatgaccatcgagaacctcgaggagctctttatgtatgagttccgtgtc
aaggctgtcaatttaattggatcaagtgaacctggaattccactcaccattgtcattcaa
gatgatgaagttcctcctactgtgaggatgttgaagaccttcaagggagatgcaatcact
gtcaagaagggagagcctattgaaatccctgctgaggtgactggtcttccaatgcccaag
gttgaatggttgaaggatgaggtgattattgtagagcccactgagactctgttgatggac
accaaggagatcaacagaatgcagtgcaataccaagctcagtatccctgcagcagcaaga
ctggacaaaggcatctttacagtgatcgcctccaaccgtcttgggacggctagtcacacc
atcaaggttaaggtgttagaccgtcctctgccacctaggaatgtgaatattggtaacatc
aaggctgagtcctgccagctaacctgggacgcgccagaggacgatggaggaagtgagctc
actaactacattgttgagaagctggacattcttcctgaggaggaacctgaagaagaatat
gaggattctgaggatgaggagcctaagcctaaatctgagcctagacccattcctgtatgg
acggtgatcaccaacagcatcattgagaaacgactcggggtttggaatctggaaacaggt
agccagtgccagttcagagtgagagcagagaacaggtatggacagagtgacgcctgcgag
acagaggcatccgtcatcaaggatctgtacggactccctggtcctccagagaaaccaaag
atcgcagagcacaccaggtcctccatgcttgtgacatgggaccctccacgagacaacggt
ggatccactatctctggctactggctggagaagagggagaaaggttcgtcttattgggct
cgggttaataaggccccggtgacgaagcgtgctgctaagcgctgggagttccaggtcgtt
cgtatgatcgaggggtctgcgtatgagttccgtgtcatggctgtcaatattgccggtact
ggaccccccagtggaccttccgatcctgcatacgcagtggaccctcttatgaaacccggc
atgccagcagcaccagaggttgcagacaaaaccaagcacagtgtcagcctcacatggtct
ccacctgagaaagacggtggaagcgccatcaagggttacatcgttgagatccaggatgaa
gcctcttctatttggatcagaatcactgatctagagactctgcatgagaccactgagatc
actgtcccaagtctcaaagagctgaaacactacaagttcagagtcacagccgtcaatgac
atcggcgagtctgacccaagtcccaagacagaagtcctaattgaggacgtacatgtggag
ccgaaaatccatattgattgcgttgtggaagattttctctgcgtccgggctggtcattcc
ttcagaatccctgccatcatcaaagggcgtcccgttcctaaggtgacctgggaattcact
ggaccagcaaagacccacaagaagaatcgccttcatgtccttccagttgactcagagctt
gaatctactgatactacctcaaacatcactgtacctgtgtgcttgaggacccactctgga
cgatacaccatcacagccaagaacaaggctggacagaaacatgtcaacgtcagagtcaat
gttctcgacgtgcctggtgctcctcgagagctcaaagtgactgacatcaccagagctact
atgaggctgatctggaaactgcctgctaacgacggtggcgagaggatcaagagttacttc
attgagaagaagaatgtgacaggaaaggcctggaccatagtaaaccagtgctgtttcagc
caggcctacgttgtggagggactgctggagggacaggagtatgtgttccgtgtgcgggca
gagaaccgtctgggaatgggacctttaactgagaccactgagcctgctagggcaagagac
cccatctacatacctgatcccccaacccacgtcaaggtcaatctggtcaccaaggataca
gtgaccctgacatgggtgccacctaagaacaacggtggttctcctgtgaagcactacatc
atagagcgcttgagttgggacaccagcggcccggagaaggagacatggaagcagtgtaac
aagcgtaacgttgaggaaaccatcttcatcattgaagatctgaaaaatggcggagagtat
gagttccgcgtcaaggctgtgaacgaggctggcccaagcagaccgtcggccaccgctgga
ccagtcatcatcaaggaccagacatgtgctcctaccattgaactgaaggaacagatggaa
ggtgaagagggactagatgtccatattgtggctaggatccatggctgtccattcccctcc
ctcgtatggcagaaggctcccattgccaagcctgaagacaaggctgtagtgcaatatgat
cagcatgtcaacaaactgatcattgataacaaatgtaccctgctgatccagcagtccaag
agagacgacagctccctgtacactatcactgctagcaacagtctgggcaaagcatctaag
gaaatcaaactcactgttctaggacgacctggcgtacctgtcgggccaatcgaattcaaa
gaggtgtttgccgagaggataacacttgcatggaaaccacctagagatgacggtggctcc
aaggttacaaactacgtcgttgagaagcgtgaggaaaacagaaagtcatgggtgcacgtt
tccgacgaccccaaagaaggcctgtatacagttcagaggctgactgagggccatgagtat
gagttccgtgtcatggctcagaacaaatatggagttggaccaccgctgtacagcgaacct
gagaaagcaaggaatctgttcactctccccggtcccccaacccccaaagtaacagactgg
accaagtcaacagtggatctggagtggatcccacctttgattgatggtggatctaaggtc
actggttactttgttgaatacatagaagaggaaaaagaagcagaaatagaaaaacagaag
gctaaagacaaggagattagaagcactaagtttgttgtgtctggactgaaagagctggga
aggtacaagttcagagtgagggcagtgaacgctgctggcgtcggtgagcccggtcaagtg
gccgaagtgattgaatgcaaggacagaacaattgcccctgaagtggacttggatgcctca
gtgaaggagaagattgtagtccatgccggtggtaccatccgcctcctggcctacgtgtca
ggcaagcctgcgccagagatcacatggagcagagatgaccagcctctaccagcagaggct
aaggttgaaaccacttcaatcagctctgctctggttatcaaaaactgtagacgccatcat
cagggtatatacaccctgagtgcaaagaatgaaggaggggaaaggaagaaggctgtcatt
gtggaggtgttggatgttcccggcccagttggtcagccgttctctggtgtgaacctcacc
attgactcttgcaagttgacctggtactcccctgaagacgacggtggctcagccatcacc
aactacataattgagaagagagagtctgaccgcatgggctggacagcggtctcttacacg
gtcaccaggcacaatgctgtggtccagggtctcatcgacggaaaaggatatttctttaga
atcgcagctgagaatatcatcggaatgggtccattttttgaatcagaacgaccagttctc
atcaaagaccctatttctgttcctgagcgtcctgaggatctagaaatcacagccatcacc
aaagactccatcagtttggcctggagaccacctaagtacgatggtggttctgaggttaca
cgttatgtgcttgaagctcgtctgattggaaaggataacttcaataagatcgatactgat
gacacgctgatggataggaagttcacaaagggaggtctcaaagagaattccacctatgaa
ttccgtgtcagtgctgtcaacgtgattggtcagggaaagcactctttctgcaccaagcca
atccaggtcaaggaagaacttgagcccccaacgatcgacttggacttccgtgacagaccg
gttgtgcgtgtgggagacgtgtgcaccctccaaggccgcttcactggaaagccagcacct
acaataacatggacaaagaacgaggaagagttgaaagcagatgaggaggtcacaatgacc
aacactagtaaaacactgtgcttggctatgcccaaggctaaacgcgaacacagcggcaga
taccaggtggttgtggagaacattgtcggcttacgtaaaggaatctgcagtctcactgtt
gttgatcgcccccagcctccagagggcccagtggtcttcaatgaggtctacaggaaccac
atggtgatttcctggaaccctcctctggacgatggtggatgtgccatctccaactacacc
attgagaagagagacacaaacagagacctctggatgccagtgacaacagcttgcaccagg
acaacatgcaaagttcctaagctgattgagggcagagagtacatcatcagaatttgtgct
gtgaacatccacggtgtcagcaacccactgctgtctgccgagaccaaggctaaggatgtc
ttcaaggtgccagatgcacccaaacagcccattgtgaaggagatctataaggatcaagcc
ctcctcacttgggaaccacctgcggatggtggcaagcccatcactggctacgtcattgag
aggaaggagaccatggctaacagatggactcgcgcatccggaaaagaccgcatcttcccc
aaagtagagtactttgttccagacctcctcaagggctgtgaatatgagttccgtgtcatg
gctgagaacgttgtgggtctgggtgaccccagccctccatcaaagcccatctttgccaaa
gatccaattgtgcttccaagcccccccgttctgccagaagctgtggattggacaaaggag
tctgtctcactatcttggcagccaccaaaagactgtggcaggggaaagatctttggctat
ctcgttgagttcagtaaagctggagaggagtggcaaaaagtgaatcagactcctgattcc
tgccaagaaaccaagttcaaggtcattaacctggaagagggagaatattacaaattcaga
gttactgctgtgaacttcgctggtgaatctgaacccgcatacaccacagatccagtgaag
gcagaagacagatttgaacctcctgagttggatgttgaactgggtatgcctcgtgagttg
aaagccatggcrggaacccatatcaatctggttgctggaatcaagggaattccattccca
aaagtcacatggaagaagaacgataaagacgtccccacaagagctgaaattgaggtcaat
ccattaggatctaaattggagatgcgctactgtgcccgttctgactgtggcgactacact
ctgaacatagaaaactcatctggatcaaggactgccacatgcacagtccttgtccttgac
aaacctggtccaatccagcacctgagggtttcagaggtgagaagcgattcagcctatctc
tcctggaaagaccctgaggacaatggaggagcacgtattaccaactttgttgtggagaag
aaagatgtggcagccgcacagtgggtgccagtgtgctcttcgtctaagaaacgaagcatg
atggccaagcacttgatggaaggaacatcgtatttgttccgcgttgctgctgagaatcag
ttcggcagaagtgaatacattgaaacaaccaaagccgtcaaagccatgaatccactgttc
ccacctggtccaccaaaggacttgcaccatgtagatgtcgacaagacggaggtctggctt
gtgtggaactggcctgaccgcaacggaggtagcaacatcataggtttcctggttgagtac
caagaggaaggagagagagagtgggatgaatggaacaccgtcagcatccctgagagccac
atcactggcctcgaggaaggaaagacttacagattccgtgtgagagcggagaacgctatc
ggactgagtagaccagacaccactgtccccgtcctctgccaggagaagcttgtggctcca
atcgttgaagttgaggccaagctgatcgaagggatcattgtgaaatgtggaagcacaatc
agactccctgctatcatgagaggcatccctgcgcctactgccaaatggtccattgacgga
gcagaaattgtacccgaaggctcagttaagattgagagtgacaactattcaacagttctc
agcatcaatgagtgtatgagaaccaacagtggaacctatattctcacagtttccaaccct
gcaggaaccaagactctggctttgaatgtgaccgttcttgatgtgcccgctgctcccatt
ggaccaatcaatgtccttgaggttactcctgagtacatgcttattgactggcgttctcca
aaggatgatggtggaagccctgtaacaggttacattgttgagaagagagaggctaagaag
gaaacctggggaggtgtgagctctggtagcacagctacaaagcttaagatctctcgtttg
cagagcggtgttgaatatgttgtgcgtatccgtgcagagaacaaaatgggtatcggcgct
cctcttgaaagtgcaccaactgtcgcccaacacacgtttgaaccccctgcccatcctggc
aaaccaaacacatgggacattgcagaagatgctctcactgttgggtggaccatgccattg
tttgatggaggcagtcaaatcactggatatatagttgagcgtaaacacaaaggcggtaaa
tggatccgtgtcaacacgacaccctgtaaggatctcagaatcagagtacttggtctcttt
gagggaaatgagtatgagtttagagttttcgctgaaaacattgctggtttcagtggacct
tctgccatatcagacccagcaaaaccctgtcgtcaaattaaagctcctggacctccagtt
aaccccagaatcaaggactacagtaaggaaaatgcagacctagtctggattaagcccaac
aaagatggaggcagtccaatcatgggctacattattgaaattcagaaagttggcggagaa
tgggagatcatcaacaaggatggtcacattaagcagtgtgcttacagagttaaaggcctt
gaagaacactcagagtacaggttccgcattagtgctgtaaatatgattggagttggagag
cctagagaatgccttggatcggtggttgccaaagacatcatgatacctccagagatcgag
atggatgccacaagccgtgagtgtttgactgtccgagttggacataacatcaacatcatc
ggttacgtgaaagccagacccgatccagagattatctggaaaaagggtgaagacgttttg
gaaaccgccaagcacacaacactaactcagaacttgcctgttgttcaactgagaataaaa
gaggcaaccagagcagaccatggaaagtatgttttgaaggctaacaactacagtggtgaa
gctgaagctacaataactgtgaatgtgttggatagacctggacactgtcagaatctgaag
gccacctatgtgaccaaagactcttgtatggtgtcctgggagaaccctgtagataacgga
ggctctgagattacaaactacattgttgagtgccgtgaacccagtgtgaggctttggtca
atgatctcatctgactgcactaaccgcatggttaaagccaaactcatggagggccacgag
tatctcttccgtgtttgtgctgcgaacaaatgcggccctgggcctacagttgagacaaaa
caaccaacccttgccatcgatcccattaacacgcctggtgagccagagaacttccacgta
accgacgtgggtaagaactttgtcttcttgaaatggaggaggccagactatgatggtgga
agccccaacattggttacgctttggagagcaaagaagcaggagcggcagaatgggtgcca
ttacacgaggatctgattacaagtacattcttcatggctgacaagtgtgtggaaaaacaa
acctatcagttcagagtgcagacatgcaatgaaggtggagaaagtgactgggtgaagact
ggtgatgtacttgttaaagaggagatccagaaaccagtgcttgatataaagttagctgga
gcccttgtggttaaagctagagagtctatcagaattgaggctggactcagaggaaagcct
caaccagaggtgaagtgggtgaaggacayggccacaggagataacccragagttagtytt
gaaacgggcacagattartcwaaattrcttwtgaccaaatcraaacgracwgacaccgga
aaatatgtrytracrgccacaaactctgctggaaccttcactggatacgcagttgttcat
gtcttggatgtcccagggcctgtgagagacgtgaaggtgtctggaatcggagtagacaaa
tgtagagttgcatgggatctcccagaagatgaaggtggatgtgaagttgatagctatatc
attgagaaatgtgagacaagaagaatggtctggtccacatactctgcttcacttgtcacc
aactattgcaatgttacccgactagtagaaggaaatgagtacatcttccgcatcagagca
gaaaacaagatggggacaggtcccgcagtggagagcaaacctgtcacagctaggactcag
ttcaacagacctggaccaccagaatcaccagagatcaccaagatcggcaaggaggaaatg
acagtcgtatgggccccaccagagaatgatggtggaaagtctatcactggttatatcctg
gaaaggaaagaaaagcgtgctgtcaaatgggtgccatgcacaaagagtaccatctctgag
agacgcatgaaagtcagcaacttaattcccaaccacgagtatcagttccgtgtcaaggcc
gaaaatgaagttggactgggagagccaagcaaaccatgcagaccagtagcagccaaagat
ccaattgagactcctggtcctccaggcagtttcaaggtgattgacagcaccaagacatcc
attactcttgggtgggccaagcctatctatgatggaggtgctcctatcattggatacatg
gttgaaatgagagacaaacctgaacctaaacctgaagtggttgaagctgaagctgttcct
gaagataaacctgcagatgaagctaagcctgaaggtgaagctaagcctgaagcagcagca
ggagaaggtgaggaaaaatatgaagaggacgctgaggatgaagctgctgcagttgcagct
aaagctaaagctgaagctaaacgtaaggagaaagaagagggctggaagaagtgcaacacc
ggtgctggtgtgctggtgcacacagaattcaccattccaaacttgaatgagaagcagatg
tatgaattcagagtctctgcacagaaccaggtcggctggggtcgtcctgctacactcaaa
gaggctgtcaaccccaaggaggtcctcgaggcaccagagattgacttggatgccagtcta
aggaagggcttcactgttagagcaggctgccccatcaggctcttcgctactatcagagga
agaccatcgcccaaagtcacctggaagaagctcggtgttgataatgtggccaggagaggg
catgtagatcagattgatactatgtccttccttgtgattcctgagagcactcgggacgac
tccggcaaatactctctcacactttccaactccgctggggagaaagctatatttgttcgt
gttaaagtattggatactcctggacctgttggaggatttgaggtctgtgatgtgacaagc
accggttgtcagctgtcttggctccctccagataatgatggtggctgtcaaatccagaac
tacatcgttgagaaacgtgaactcgacaagaagacttggtcaaattgtatcaacgacttg
aagaaaacaagcttcaaagtcaccggcctcacacctggctgtgactactacttcagagtt
atggcagtcaataaatatggcattggtgttcctaaagactctccaaaagcctacctgaca
actgatcctataagtgaacctgatccacccaagaagatggatgtcttggaagtgacaaag
aacagtgccactctgggatggctgaaacctttgagggatggtggagctaagatcaatggc
tacatggttgattacaaagaggatggcgaacctgaagacaaatggacaccatattccgtt
gttaaagacttaaccattgtagtcgttggacttaaagagggcacaaagtacaagttcagg
gttgcagcaagaaacgtggctggaaccagtctggcaagagaagctgagggagtatttgaa
gtcaaggagcagctgatggcaccaaagatcatcatgcctgatattgtcacagtaagggca
ggagagaaaatgagaattgatgctattgtggctggaaaacctacaccattctgcaaatgg
aggcaaggagccgatgatctgttgacatctgatcgtctcatggtgcaaaagtctccaaac
tgcatttcactcatcatgaaagacgtctcgagaaaggacagtggttactacagtctttct
gctgcgaacagcaccgccaaaataagccagatccttagagtcatagtacaggataaacca
gggcctcctgacgctcccctggagatcgttgagcttgatattgatgcctgcacactccag
tggaaccaacccagtgaggatggtggaagcaacatcactaactacgtcattgagaagtgt
gatgtaagcagaggagactgggtcatagcttctggctcatgcaccacaaccagctacaga
gttggcaagcttacccctggaatggagtatggcttccgtgtccgagctgagaacagattt
ggcatctcggagccaatctattcagagaaaagtatcgctagatatcccttcgatgtccca
gacgagcccagaaatctgtgtatcacgaaagttaagagtgaagcagtgtctctgtcctac
gagaccccatcaactgacggtggcagtcctcttaccggatactgcattgagcgtaaagag
aggaacagccttctctgggtaagagcaaatgagtctgttgtccgcggacttgaatacaac
tgcacaggcttaatggaaggtctggaatatgcattcagggtgtctgccctcaacaaggcc
ggccagggtaaaccaagcaaacagactgactgggtcacagcaagaacacccatcgatcca
cctggtaaacctgaggtaatggatgtgacaaagagcactgtttcacttgtttggactcgc
ccccaaaatgatggaggtagcaagctcattgggtactatgtggagtacatgaagattggt
caagaagtagagaaatgggttcgctgcaatgccaactgccagaacgtcaaaacagaagac
tatgttgtaactggcctggaggagggagcccagtatcacttcagagttttcgccaagtca
gcaatcaacatcagcttgccttctcagatctcagatgccattccagtgtttgcagagaat
gttccccccagggtcgagctgggagtggacatgaagaatatgatcatagtgaaggctgaa
gaaaatgtctcctttgatgcagtagtgtttggaaaaccactgcccaaggttacatggaag
agagatggtgttccattgaaactggttgatgggatgaagatgacacagaagagacacaca
cacattctggaattgttctctgttgcaaggaaggagtctggagagtacactattctagct
gaaaatcccaatggcgctaaatacgccaatattaagctcaaggttctagacaaaccaggc
ccaccagccggagtgaaagtcaccaaggtgtttgcggaccgtattaaaatgaggtgggag
ccacctgttgcagatggaggctctgaaatcatcaactacatcattgacaaacgtgaaacc
agcagagcgaactgggctctggtcacctccaatatccatggtcaactgactgattgcaca
gtagataaactgatgcaggaccatgaataccagttcagggtcagtgctgagaaccagtat
ggtattggggaccccatcctcaccgaccctgtcatggtcaagaatccatatg

DBGET integrated database retrieval system