KEGG   Salvelinus alpinus (Arctic char): 112070941Help
Entry
112070941         CDS       T05762                                 

Definition
(RefSeq) erlin-1
  KO
K23341  erlin
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:salp04121]
    112070941
Ubiquitin system [BR:salp04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    112070941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7
Motif
Other DBs
NCBI-GeneID: 112070941
NCBI-ProteinID: XP_023994165
Position
Unknown
AA seq 328 aa AA seqDB search
MTMTHVGAVVGAVTAVMAILLHSSIHKIEEGHLAVYYRGGALLTTPNGPGYHIMMPFLTT
YRSVQTTLQTDEIKNVPCGTSGGVMIYFDRIEVVNMLVPSSVVDTVKNYTADYDKTLIFN
KIHHELNQFCSVHTLQEVYIELFDIIDENLKIALQKDLNSMAPGLTIQAVRVTKPKIPEA
IRRNFELMEGEKTRLLVTVQTQKVVEKEAETERKKAVIEAQKLAEVAQIHFQQKVMEKET
EKRISEIEDTAFLAKMKARADAEYYTAAKFAEANRLKLTPEYLELMKYQAIAANSKIYFG
QDIPNMFVEGHSPTQDPEPPKASEQARR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgactcacgtgggggcagtagttggtgcagtaactgcagtgatggccatcctg
ctgcactcctccattcacaagatagaggagggacacctagctgtttactacagaggagga
gctttgcttaccacacccaacggcccgggataccacattatgatgccctttcttaccacc
tacagatcagtacagacgactcttcaaactgatgagataaagaacgtgccttgtggaact
agtgggggagtgatgatctacttcgaccgtatagaggtggtcaacatgctggtgccctca
tctgtggtggacacggtgaagaactacacagctgattatgacaaaactttaattttcaac
aagattcaccacgaactcaaccaattctgcagcgtacacactttacaggaggtctacatt
gagctgtttgacatcattgatgagaacctgaagatcgctctgcagaaagacctcaactct
atggcgcctggactgacgatacaggctgtccgagtcaccaagcccaaaatcccagaggcc
atcaggagaaactttgagctcatggagggggagaagactcgtctgttggtaacagttcag
actcagaaggttgtggagaaagaagctgagaccgagaggaagaaagccgtcatcgaggct
cagaagctggctgaagtagcacagattcatttccaacagaaggtgatggagaaagagact
gagaagaggatctctgagatagaggacactgcgttcttggcaaaaatgaaggccagggct
gatgcggagtattatacagcagctaagtttgctgaagctaacaggttgaagttaacaccc
gagtaccttgagttgatgaagtaccaggcgatagcagccaacagtaagatctacttcggc
caggacatccctaacatgtttgtcgagggacacagccctacccaggaccctgagcccccg
aaagcctctgaacaggccagacgctaa

DBGET integrated database retrieval system