KEGG   Salvelinus alpinus (Arctic char): 112071104Help
Entry
112071104         CDS       T05762                                 

Gene name
gpx8
Definition
(RefSeq) probable glutathione peroxidase 8
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00480  Glutathione metabolism
salp00590  Arachidonic acid metabolism
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    112071104 (gpx8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112071104 (gpx8)
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     112071104 (gpx8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 112071104
NCBI-ProteinID: XP_023994345
Position
Unknown
AA seq 215 aa AA seqDB search
MEALEVLGGYPTKPSNPRSRMVRVLLSMTVVMGCLLMLHSFLKIAKSRKPQDFYSFEVKD
AKGKSVSLERYRGKASLVVNVASHSEHTENNYRSLQELHRELGTSHFNVLAFPCGQFGET
EMGTSRDIEANAKKTHGVTFPIFSKIKVMGSEAEPAFKFITDSVKRIPKWNFWKFLVNPE
GQVVRYWKAEEPAESVRQEATAMVRQIILKKRAEL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctggaggttttggggggctacccgaccaagccatcgaaccctcgatcacga
atggtcagggttctactaagtatgactgttgttatgggatgtttattaatgttacatagt
tttctcaaaatcgctaagtcgcggaagccgcaagatttctactcttttgaggtgaaggac
gccaaagggaaaagcgtttctctggagcgataccgaggcaaagcgtctctggttgtcaac
gtggcgagccacagcgaacacacagagaataactatcgctctctgcaagagctgcaccgg
gaactgggaacgtcccatttcaacgtgctggcttttccctgcggccagttcggggagacc
gagatggggaccagccgggacatcgaggccaacgccaagaaaacccatggtgtcaccttc
cctatcttcagtaagatcaaagtcatgggatcggaggcggagccagctttcaaattcata
acagattctgtaaaaaggattcctaagtggaacttctggaagttcctggtgaaccccgag
ggccaggtggtgaggtactggaaggcagaggagcccgccgagagcgtgcgtcaggaggcc
acagccatggtgcgccagatcattctgaagaaaagggcagagctctaa

DBGET integrated database retrieval system