KEGG   Salvelinus alpinus (Arctic char): 112072165Help
Entry
112072165         CDS       T05762                                 

Definition
(RefSeq) heat-stable enterotoxin receptor-like
  KO
K12320  heat-stable enterotoxin receptor [EC:4.6.1.2]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00230  Purine metabolism
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112072165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    112072165
Enzymes [BR:salp01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     112072165
Protein kinases [BR:salp01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   112072165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 112072165
NCBI-ProteinID: XP_023995360
Position
Unknown
AA seq 916 aa AA seqDB search
MLNSIFFLCVGVLFVALVESRMLDKCMKSKPKYTMNVVLLEDQTSDWSLRLVKVAVLQAI
EADRQLNIAAGLNTKLTANFNGFNTTLYKRRGCGSSTCEGVEILKSLHTKGEVGCAMLGP
SCTFATFFMVDVEIGLTLTIPIISAGSFGLSCDYKANLSRLLPPARKISNFFVHFWNFTR
HGLKMHWGSAYVYKKADQTEDCFWYINALEAPSVQFAMSISREMLRSKKELKKAIQSENR
HSNVFILCGTPDDITTIKNETTIPPEIVFILIDIYKQGEHQNIVHAWYKTLFVFDTSINE
TRVEDSTPSLPWPGSQLPDDKPINPNDLKTEDIIVIVLSVSVVVVTAIALIFYRSNMHHT
NLRERVDKLLRIDYYNLTKFYGTVKFEYGLFGVFEYCERGSLRYVLNDTISYPEKTFMDL
EFKISVMYDIAKGMSYLHSSNIEVHGRLKSSNCVVDNRMVVKITDFGCNTILNPCKDLWT
APEHLRKQGISQKGDVYSFAIIAQEIILRKNPFFTQACSDIAEKLYMVQYPCQTGFFRPD
LNFETAAENEAELYMLIKNCWEEDPERRPDFKKIEGSLGKIFSNLHNQANESYMDNLIRR
LQMYSXNLEHLVEERTSLYKAERDRADRLNFLLLPAPVVRSLKETGSVEPELFDEVTVYF
SDIVGFTTLCQYSTPMEVVDMLNDIYKNFDRILDHHDVYKVETIGDAYMVASGLPRRNGN
RHAVDIAHMALDILAFVGTFQLQHLPGIPLWIRIGVHSGPCAAGVVGNKMPRYCLFGDTV
NTASRMESAGLPLRIHVSQPTINILQRTDCKFEYEQRGETFLKGKGNEMTYWLTGVTGTE
YNLPTPPTAENFQRLQQDLSEMIVSSLENRGPGTNGMEKRKTLSTRVRRRETNGSQEDGL
PEYLHLAITDIPSTYL
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgctgaattcaattttttttctgtgcgtgggagtcttatttgtggcacttgttgagagt
cgaatgctggacaaatgcatgaaatcaaaacccaaatacacaatgaacgttgtacttttg
gaggatcaaacttcagactggagccttaggcttgtaaaggttgcagtgttgcaagcaatt
gaagcggaccggcaactgaacattgcagcaggtttgaacaccaaattaacggctaatttc
aatgggttcaacaccacactgtacaaacgaagaggctgtgggagcagcacctgtgaggga
gtggagatactcaagtccctgcatactaaaggtgaggtgggatgtgccatgctgggaccc
tcctgtacatttgccactttctttatggtggacgtggagataggcctgacmctgactatc
cccatcatctccgccgggagcttcggtctgtcctgtgactacaaggccaacctgagccgc
ctgctgcccccggcacgcaagatctccaacttctttgtccacttctggaacttcaccaga
catggtctgaagatgcactgggggagcgcttatgtctacaagaaggcagaccaaactgaa
gactgtttttggtacatcaatgctctggaggcaccttcggtccagtttgctatgtcaatc
tcaagagagatgctacgcagcaagaaagagctaaagaaagctattcagtctgaaaacaga
cacagcaacgtattcatcctctgtggaaccccagatgacatcaccactataaagaacgaa
acaacgattcccccagaaattgtcttcatcctcatcgatatctataagcaaggtgagcac
cagaacattgtccatgcttggtacaaaaccctgtttgtgtttgatacgtccataaatgag
accagagtggaggacagcaccccctcactgccctggcccgggtctcaactcccagatgac
aagccaatcaaccctaacgatctgaagacagaggatatcattgtgatcgtcctgagtgtc
agtgttgtggtggtgactgccatcgctctgatcttctacaggtcaaatatgcaccacacc
aacctccgagagagagttgacaagctcctgcgtattgactactacaacctgaccaagttc
tatggcacggtgaagtttgagtatggcctgtttggagtgtttgaatactgtgagagggga
tccctgaggtatgtccttaatgacacaatctcctatcctgaaaagaccttcatggacttg
gaattcaagatatcagtcatgtatgacatagctaagggcatgtcctacctccactccagc
aacattgaggtccatggccgactgaagtcctcaaactgtgtggtggacaaccgcatggtg
gtcaaaatcacagactttggctgcaacaccatcctcaacccctgcaaagacttgtggacg
gctccagaacacctccggaagcaggggatctcccagaagggggacgtctacagctttgcc
atcatcgctcaggagatcatactgaggaagaaccccttcttcacccaggcctgctccgac
atcgcagagaagctgtacatggtgcagtacccatgtcaaactggcttcttcaggccagat
ctgaactttgagacagcagcagaaaacgaggcggagctttacatgctgataaagaactgc
tgggaagaggacccggagaggaggccagacttcaagaaaatagagggatctctgggtaag
atattcagcaacctgcacaaccaggctaatgagagctacatggacaacctgatccgtcgg
ctgcagatgtactccargaacctggagcacctggtggaggagagaacctctctgtacaag
gctgagagggacagggctgacagactcaacttcctgctcctgccagccccagtggtgcgt
tccctgaaggagacgggcagtgtggagccagagctgtttgatgaggtgacggtctacttc
agcgacatcgtgggcttcaccaccctgtgccagtacagcacgcccatggaggtggtggac
atgctcaacgacatctacaagaactttgacaggatcctggaccaccatgatgtatacaag
gtggagacgatcggtgatgcgtacatggtggcgtcagggttgccgcggcgcaatggcaac
cggcacgcagtggacatcgcccacatggccctggacatcctagctttcgtagggaccttc
cagctccaacacctaccgggcatacccctgtggatccgcatcggggtgcactcagggccg
tgtgcggcgggtgtggtggggaacaagatgccacgttactgtctgtttggagacacagtc
aacactgcctcacgcatggagtccgcaggcctgccactaagaatccatgtcagccagccc
accataaacatcctccaacggacagactgcaagtttgagtatgagcagagaggagagacc
tttctgaagggtaaaggcaatgagatgacatactggttaacaggggtgacggggacagaa
tacaacctgccaacgcccccgacagcggagaacttccagaggctacagcaggatctgtct
gagatgatcgtgtccagcctggagaacagagggccggggaccaacggcatggagaagagg
aagaccctctccaccagagtcaggaggagggagaccaatgggagccaggaggacggcctg
ccagagtacctacacctggccatcacagacattcccagcacctacctgtag

DBGET integrated database retrieval system