KEGG   Salvelinus alpinus (Arctic char): 112076749Help
Entry
112076749         CDS       T05762                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp03040  Spliceosome
salp04010  MAPK signaling pathway
salp04141  Protein processing in endoplasmic reticulum
salp04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:salp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112076749
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112076749
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112076749
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112076749
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:salp01009]
    112076749
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:salp03041]
    112076749
   03009 Ribosome biogenesis [BR:salp03009]
    112076749
   03110 Chaperones and folding catalysts [BR:salp03110]
    112076749
   04131 Membrane trafficking [BR:salp04131]
    112076749
   03051 Proteasome [BR:salp03051]
    112076749
   03029 Mitochondrial biogenesis [BR:salp03029]
    112076749
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:salp04147]
    112076749
Protein phosphatases and associated proteins [BR:salp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112076749
Spliceosome [BR:salp03041]
 Complex B
  Other components
   Prp19 complex
    112076749
 Complex C
   Prp19-CDC5 complex
    112076749
Ribosome biogenesis [BR:salp03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112076749
Chaperones and folding catalysts [BR:salp03110]
 Heat shock proteins
  HSP70 / DNAK
   112076749
Membrane trafficking [BR:salp04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112076749
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112076749
Proteasome [BR:salp03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112076749
Mitochondrial biogenesis [BR:salp03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112076749
Exosome [BR:salp04147]
 Exosomal proteins
  Proteins found in most exosomes
   112076749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70
Motif
Other DBs
NCBI-GeneID: 112076749
NCBI-ProteinID: XP_023999199
Position
Unknown
AA seq 111 aa AA seqDB search
MSSEKGVSIGIDLGTTYSCVGVFQHGKVEIIANDQGNMTPPSDVAVTNTQRLIGDAAKNQ
VAMNPTITVFDAKTSDRQEVQRPDRSVRHETVAFYMFIYLFTIFKNTSSNL
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagaaaagggagtatccattggcattgacctgggcaccacatactcctgtgtg
ggggtgttccagcacggcaaggtggagatcatcgccaacgaccagggaaacatgaccccc
cccagcgatgtggccgtcaccaacacacagagactcatcggtgacgcagcaaagaaccag
gtggccatgaaccccaccatcactgtgtttgatgcaaaaacgtctgatcggcaggaagtt
caacgaccagatcgttcagtcagacatgaaactgtggccttttacatgtttatttattta
tttaccatttttaagaatacaagctctaatttataa

DBGET integrated database retrieval system