KEGG   Salvelinus alpinus (Arctic char): 112076941Help
Entry
112076941         CDS       T05762                                 

Definition
(RefSeq) cysteine--tRNA ligase, cytoplasmic-like
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:salp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    112076941
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:salp01007]
    112076941
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:salp03016]
    112076941
Enzymes [BR:salp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     112076941
Amino acid related enzymes [BR:salp01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   112076941
Transfer RNA biogenesis [BR:salp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    112076941
 Prokaryotic type
    112076941
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 112076941
NCBI-ProteinID: XP_023999340
Position
Unknown
AA seq 221 aa AA seqDB search
MASLTPSSRKTVLDFNVSDDDVRRHSTQILETFGAIEGSEPIGFPVGGDGHHGDMETTVM
PYLNVLSDFRESVRKIAREQNVTEVLQLCDVVRNDTLPELGVRLEDHEGLPTVVKLVDKE
TLLRERNEKKKMEDEKKNKKEEAAKKKQEQELAKLAKMKISPCDMFRSETDKYSSFDETG
FPTRDVEGKDLSKGQTKKLRKLYEVQEKLHQEYLQTNQNGC
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtctgactccctcttccaggaagactgtcctggactttaatgtgtctgatgat
gatgtgaggaggcactccacccagatcctggagacctttggggccattgaagggtccgag
cctattggattcccagtgggaggagatggtcaccatggggatatggagaccacagtgatg
ccctatctgaaygtgctgtcagacttcagagaatctgttcgcaaaatcgccagagaacag
aatgtgacagaggtgctacagctgtgtgacgtggtccgtaatgacaccttacctgagctg
ggggtgcgcctagaagaccatgaaggccttcccactgtggtgaagctggtggacaaagag
accctgctgagggagaggaatgagaaaaagaagatggaggacgagaagaagaacaagaaa
gaggaggctgccaagaagaagcaggagcaggagttggccaaacttgcaaagatgaaaatc
tccccatgcgatatgttccgctctgaaaccgacaagtattccagctttgatgaaacgggt
ttccccacgcgtgatgtggaggggaaggatctcagtaagggacagaccaagaagctgcgg
aaactctacgaggtccaggagaaactgcaccaagagtatctccagaccaatcagaatggc
tgctga

DBGET integrated database retrieval system