KEGG   Salvelinus alpinus (Arctic char): 112079432Help
Entry
112079432         CDS       T05762                                 

Definition
(RefSeq) myotubularin-related protein 6-like
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00562  Inositol phosphate metabolism
salp01100  Metabolic pathways
salp04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112079432
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112079432
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:salp01009]
    112079432
Enzymes [BR:salp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     112079432
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     112079432
Protein phosphatases and associated proteins [BR:salp01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    112079432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related Ezh2_MCSS IFP_35_N DUF1319 Xylo_C
Motif
Other DBs
NCBI-GeneID: 112079432
NCBI-ProteinID: XP_024001161
Position
Unknown
AA seq 194 aa AA seqDB search
MMVMMPTLPQAFEFNEWLLLQIHEHVHSCQYGNFLANNQRRREELQLKDRTHSLWAFLLS
EGQNYLNPAYCPAYAETHPVLEPSTLPCHLKFWRNMYHQFDRSMHPRQSVLKNVLTLKES
NRQLEDTIKKLEARLQKHGISPPTPDPQAPPKDQRTLPNHTRPHSLILGAPLSRKEAQHQ
EEVGEEAKECCSVQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgatgatgcctactcttcctcaggcgtttgagttcaatgagtggctgctgctg
cagatccatgaacatgttcactcctgtcagtacgggaacttcctggctaacaaccagaga
cggagagaagagctgcaactcaaagacaggactcactctctgtgggcgtttctgttgagt
gaggggcagaactacctaaaccccgcctactgccccgcctacgcagagacacaccccgtc
ctagaaccctccaccctgccctgccacctcaagttctggaggaatatgtaccaccagttt
gatcgttccatgcacccccgtcagtctgtcctgaaaaacgttctcaccctgaaagagagc
aaccgccaactggaagacacaataaagaaactggaggctagactacagaagcatggcatc
agcccccccaccccagacccccaggccccccctaaagaccaacgcaccctccctaaccac
acacggccccactccctcatcctgggagcccccctcagccgtaaggaggcgcagcatcag
gaggaggtgggagaggaggcaaaagaatgctgcagtgtgcagtga

DBGET integrated database retrieval system