KEGG   Salvelinus alpinus (Arctic char): 112079495Help
Entry
112079495         CDS       T05762                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK1-like isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    112079495
   01009 Protein phosphatases and associated proteins [BR:salp01009]
    112079495
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112079495
Protein kinases [BR:salp01001]
 Serine/threonine kinases: Other
  Wnk family
   112079495
Protein phosphatases and associated proteins [BR:salp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112079495
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 112079495
NCBI-ProteinID: XP_024001201
Position
Unknown
AA seq 939 aa AA seqDB search
MRQNQGQYDPGPSTAPPSIHIASLPVLVPAAATTTTIPVPAAATTTTIPVFSTAPIASAL
IPHAQVSSEASVTSPPPSVSISPPASTSPPATIHQATAPLPTQLQSVATQPLLSQAPLTL
PVTQPVVSSVPSVTAPVPAPATSVSPPAPAVLPTSASFPQTSGPGSIPGGPTTSIPTTVL
CHSATAPLVSSCSSGSGGGGSSEQLPVPSTAVPQFTATVVPTTAVQGPLLAPSIANPSAE
LPSSSSPVASLGPGATVPTLQPVTTTIPVVQPTLVHTQPQPATMPNQTHAQGGECEAALG
IDDIHALDKKLRSLFMDLGGGGTTQADGSVDPAGGTGVPGTSSPTGPSSTASSTGTPLPP
SSLPLASSGPGHVSGTPLTTPGQAGTPSTYTQTTPAKAPLSRLPVLPVGSDQAQAGPPPP
SDHMAPFPGPCLTQSQQPLEDLDAQLRRALSPETVSVSCVXTQSSLTGMPAGGQPVPFSL
EGEPITSPIAGGFQLGRFQVSVAADQGPHKIERGSPTKSSSSSTSSSSSSLSSPENTLHN
VSSPLRGGKTGGGDVVDGLPSLPHRTASPQPTTIGRFQVTNAPDARVGRFSVSRAQDEAA
EALFEQPPASQANGPSTDPDLATMLFSPEDKQSSLPSLNNSYMSSDNDSEFEDEDLKREV
NRLREKHMKEIQALHTKQKDEIDSLFARLGKVPPAVVVPPAVALAGRRRRPTKSKSSKSS
RCSSSQGSKSPLQPGTSSTNTVSGPGGQGPGGQGPGPGGQNQPSPNPPQQGRKGTFTDDL
HKLVDNWARDAISLSQGKSRSKQQPSQGLRYQATPSTNKGRKFSAPSQLCPSNASSTPAT
SLGGRKGSLCPLPQYGGGGACYPSSTAPYSSAQWVGSTGSTGPGQGQAGVLASSQPLVAS
SSQYPSSATGGQGSLQGFHHISTLQKSVSNPGGPNLRTT
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgagacagaatcagggccagtacgacccaggacccagcaccgctcctccctccatccac
atagcctccctgcctgtcctggtccctgctgcagccaccaccaccaccatcccggtccct
gctgcagccaccaccaccaccatcccagtcttctccactgctcctatagcctctgctctt
atcccccatgctcaggtttcatctgaggcctctgtgacctcccctcccccctcagtctcc
atctcccctccagcctccacctccccacctgcaaccatccaccaggccaccgcacccctc
cccacccagctccagtctgttgctacccagcctctcctttcccaggcccctctcaccctg
ccggtgacccaacccgtggtctcctccgtacctagtgttacagccccagtccctgcccca
gccacctctgtgtcccccccagcccctgctgttctccccacctcagcctccttcccccag
acctctggcccaggctccatccctggtggtcccaccacctccatacccactacagtcctt
tgtcattccgccacggcccccctggtcagcagctgtagcagtggtagtggaggtggagga
agctcagagcagctccctgtcccttccactgctgtcccccagttcaccgctaccgtagtc
cccaccacggctgtccaaggccccctgctagccccctccattgctaaccccagtgcagag
ctcccttcttcctcctcgcctgtagcctctctaggcccaggggccacggtccctacctta
cagcccgtgaccaccaccatccccgtggtccagcccaccctggtgcacacccagccccag
cccgctacaatgcccaaccagacccacgcccagggtggygagtgtgaggcggccctgggc
atcgatgacatccacgccctggataagaagcttcgctccctcttcatggacctgggcggc
ggtggaaccacccaggccgatggctctgtcgacccagccggaggcactggtgtcccggga
acttcttccccaaccggtccctcatccaccgccagctccacaggcacccccctgcccccc
tccagcctccccctggcctcctcaggaccagggcatgtctctgggacccccctcaccacc
ccgggacaggctgggaccccttccacctacacccagactacccccgccaaagcacctctg
tctaggttaccggtgttgcctgtgggctcagatcaggctcaggctggcccccctcctccc
tcagaccacatggcacccttcccaggaccctgtctaactcagtcccarcagcctctggaa
gacctggatgcccagctgaggagggccctgagcccagagactgtctctgtcagctgtgtc
wccacacagtcctccctcactgggatgcctgcaggtggccagccagtgcctttctcgctg
gaaggggaaccaatcacgtcgcctattgctggaggattccaactgggacgattccaggtc
tctgtggctgcagaccagggtccccacaaaatcgagagaggaagccccacaaaatcctcc
tcctcctccacctcctcttcttcctcctctctctccagcccggagaacacactgcacaat
gtctcctcccctctccgcggcggtaagaccggtgggggagatgttgtggacggcttgccc
tccctcccccaccggaccgcctcccctcagcccaccaccattggccgcttccaggtcacc
aacgcaccggatgccagggtgggccgcttctcagtgagccgagcccaggatgaggcagcc
gaggctctgttcgagcagccacccgcttcccaggctaacgggcctagtactgatcctgac
ttggccaccatgctcttcagcccagaggacaaacagagctccctgcccagcctcaacaac
tcctacatgagctctgataacgactctgagtttgaggacgaggacttgaagagggaggtc
aaccggttacgggaaaagcacatgaaggagatccaggccctgcacaccaagcagaaggat
gagattgactccctgttcgccaggctgggcaaggtgcctccagccgtggtggtccctcca
gctgtagccctggccggtcgcaggagacgacccaccaaaagcaagagcagcaagtccagc
cgctgcagctcctcccagggcagcaagagccccctgcagccagggaccagcagcaccaac
acagtgagtggtccaggaggccagggtccaggaggccagggtccaggaccagggggtcag
aaccagccttctcccaacccgcctcaacagggccggaagggcacgttcaccgacgacctg
cacaagctggttgacaactgggcccgcgacgccatcagtctgtcccagggcaagagtcgc
tccaaacagcagccctcacagggactccgctaccaggcaaccccgtcgaccaacaagggc
cgtaagttctccgccccgagtcagctgtgccccagcaacgcctcttccacccccgctacc
tctctgggaggccgcaagggctccttgtgtccccttccccagtacggcgggggcggggca
tgctacccctcctccactgcaccttacagcagcgcccagtgggtgggatccacggggtcc
acagggccgggacagggtcaggccggtgtgttagcatcctctcagcccctggttgcctcc
tcctcgcagtacccctcctctgccactggggggcagggctccctgcagggcttccaccac
atcagcactttgcagaaatccgtcagcaaccctggaggccccaacctgaggaccacgtag

DBGET integrated database retrieval system