KEGG   Salvelinus alpinus (Arctic char): 112080198Help
Entry
112080198         CDS       T05762                                 

Definition
(RefSeq) rho-associated protein kinase 1-like
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04270  Vascular smooth muscle contraction
salp04350  TGF-beta signaling pathway
salp04510  Focal adhesion
salp04530  Tight junction
salp04810  Regulation of actin cytoskeleton
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112080198
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112080198
   04530 Tight junction
    112080198
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112080198
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112080198
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112080198
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    112080198
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:salp03036]
    112080198
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112080198
Protein kinases [BR:salp01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   112080198
Chromosome and associated proteins [BR:salp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112080198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Seadorna_VP7 APH Kinase-like Haspin_kinase Kdo Pox_ser-thr_kin Choline_kinase
Motif
Other DBs
NCBI-GeneID: 112080198
NCBI-ProteinID: XP_024001719
Position
Unknown
AA seq 98 aa AA seqDB search
MVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDGIHAMGFIHRDVKPDNMLLDKAG
HLKLADFGTCMKMNKVAIALAFQRTVTDNEKLIDTITL
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggtgatggagtacatgcccggcggagacctggtcaacttgatgagcaactatgacgtc
cctgagaagtgggcccgcttttacaccgccgaggtggtgctggctctggacgggatccac
gccatgggattcatacacagggacgtgaagcctgataacatgttgctagacaaagcaggc
cacttgaagttggcagactttgggacctgtatgaaaatgaacaaggtagctatcgcacta
gccttccaacgcaccgtgactgataatgagaagttaattgacactatcaccctgtag

DBGET integrated database retrieval system