KEGG   Salvelinus alpinus (Arctic char): 112080766Help
Entry
112080766         CDS       T05762                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK2-like isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    112080766
   01009 Protein phosphatases and associated proteins [BR:salp01009]
    112080766
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112080766
Protein kinases [BR:salp01001]
 Serine/threonine kinases: Other
  Wnk family
   112080766
Protein phosphatases and associated proteins [BR:salp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112080766
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 112080766
NCBI-ProteinID: XP_024002438
Position
Unknown
AA seq 2895 aa AA seqDB search
MESGTEHDGFKYPSVPNSQCDLNINIYETISDGNINNMGTSTVVRGGSDPSSYPPSNYQL
IVRQRFIRRSLWFSDSDEQAFEVPECDNSSKILNINLRTIVDRTRGAWSGPQEGSSTESQ
GGQKDSATESASADEKEKAGDTLNVASTDGSKNAIRTASDENEEEAEMKAVSTSPGGRFL
KFDIELGRGSFKTVYKGLDTDTWVEVAWCELQDRKLTKVERQRFKEEAEMLKGLQHPNXV
RFYDFWESPLKGKKCIVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLHFLHTR
APPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEHYDE
SVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGVKPASYNKVVDPEIKEIIGECIC
QKKEERYSIKDLLNHAFFAEDTGVRVELAEEDDGKKAAIALKLWVEDPKKLKGKYKESGA
IEFTFELEKESSEGVAQEMVESGFFHESDAKIVGKSIRDRVALIKWRRERTVSARLPVNQ
GEAGLRAQATLAQGTSAGATRAGQPSLIEANEPEADQHARLCNPPASATSVTSDSTFDSG
LGSTVFSDSHSSQHNVLYQSQVESVTMSTQQRQCLASARPRSCERGEGWKAALGPEFRVG
AGTRRGSASVIDTLRGNNDIPLHMLLQPITSGSCSQQRASSPAPTSPDDQSESSPSESRS
EDGFPSPSAFPTPILLAPPSPTYSEARRHSDSSIESPTLEATNGSRLKSVEAAVGRRHSD
LSTLQSLNSALQHHHHHQGAPRNHLCQACLSLLLLKSREGGHKKHTAFPFPPHPCACPHR
HHHFSSGMTTTAGSGGMKGPSHTGSDFSDLSLLQKNLMNIISRKTTPSNQGQASLLHLPA
AQQPVRSYGDGSLKLTQRGSFSGDHTAPPLARPTQDHKASYCAGEHQATGPPGVPSAVHA
LLQNQSSLQGQPASAPSLYTPLQYLQPGHSYPASPLAAQQTPTAAGYSAAALQHSPASAT
YSASNIPLQHNHTXHSYPAPALQKIATAASHSTANVPLQQPAASFSAATLPLQQPHTAAT
MPIQQTPTPQSYVAPTQQQITQTAASYPGPILQQTPTAASFSAAVAMPVQHTVLAASIGT
ATIPSQPAAQSYPAPVERLRHPAPPQSYASVAPTVVHTVHIPSLPTQAPNVATQPPAAAA
LPPVQPCPAPHSLPATAMPLSLQPGQSSPMHHSQQTVPVPIQQQHSQPMHQPSAQHSQQP
VQASIQQHNQQTVQVPLPKNSQTMAQPTVQQAPVVQSYQSPAHAVQQGSTLQSYPNAAPL
MGQPNAASQSYPPTAPHIKQQAAPVQGYTPTKPSAMGQAYPSALTPQQAAAPQTYPVAPI
VQQQTGTATPQHSQAQAATLPLGQQNFPAAQSLSQLHQSSSSLPSQASPPQQLLAQASVP
QQLQPLQISTSLPPTHLPQFSSPYPNIQVVTSLTGCDIYPHPCSVPQSYPSSLPPLYLSP
GQPATLPPSVSPLAPLHIGNALVPPTSVSLIPSPTTLLAMATPTLPQHLQMYPAVLQQSV
MTHTHPHTQLPTLTHPVHSHLASLPGQQNTKPQNTHHMHPNPAAVRLPFQHVTHPTYSHP
TAAPELALPSFLPLRQQVQQQAKAQLPDAVPFAQANQPSQPAVFSPPIQTVPDPGTGTAA
TQLDLIQNPSQTQSQHQAQGQSQPQAPAPLPPDSQTAAPWPASTSLTQQNQASASSCSGT
TLTSGQAQTESNLEDPGAEKQASGASYSYDSVNSDATSGKEMSDGNEGTHGSGKGEGKVR
KHHRRSTRTRSRQDKINKPKLSMLNVCYTGDKMVECQLETHNHKMVTFKFDLDGDAPEEI
ATYMVENDFILLLEKEMFIEQLKDIVDKAEDMLSEDTEGERISDHVGSPQQSHGAVILGG
EGSKTATPNSPQLVYQQNVLHTGKRWFIICPVAETPTPDRERTSSDTSTTKEAPVTSLSR
SSCSTTPPVSAPTPVLALTTTSPTPGPSAPQSSAQSQDTNVGKARVQQPQASGTKPSTTS
ATAAAMGRRNSLSGSEPCISMVTDIPCCPIGPPVSLDVNGAGHKGMSGTSSCLPNQEASL
SGDPPPPLGSHQPVVLQQPYAMQSMVGGGGGATTPSQPQSPAHQASQQQDGPGGSGSGGG
CGLGESDGEGPPRVEFVDRTIKTLDEKLRNLLYQEYTQSAPSSTASDLQGSITEGVSSPP
VSDCQTTSGGGLPRKGEVLPQIPERTDSLGTLSDSAGLLXRRDCVGSSSSYVSKSRFQII
PTPPDVIRRLENSRSGSSPAPSSGLVGSRAAAEGGGPRDQGCMVVGRFSVMTTEEGAENA
PKPPCSNRYSAPPDLYQDTTASSPNATPSLRPRAHTADAATNHSFHFDSDSGEEDTSSLA
PPLAYHKTPAHALPEHSGSDLMKRAVAFLRRTRRSSVQSSDSPSRQCVVANGHAISPPGP
GHVSYVSSDNDSEFEDADMRKELQRLREKHMKEISELQAFQRSEIERLYKELGKALPPGV
GQLHAAPPSGRRRKVSKHKLKAGKLLNPMVQQLKNSLNTTTTVFLSEGESAPSSSGSPAK
SSIVSDGSARSSGSSSSTRGTRPSKAPEPVQTQQPCSLKGSFSSDNIYGGGMATHVGPGQ
GWTVYHQTSERVTYKSSSKPRARFLSGPVSLSIWSTLKRLCLGKERSSRSSHGASATQTA
SNQQQPPAVPNPLPSPQPMTVLAQAQANNSNNKKPGTFTDDLHKLVDDWTKETLAATQPR
PSLNQIKQQRRMQDLEGQATPLGGATQEVRCPIPPNKFQLPLSCPLTAALGPAMPTALSS
NPSAMLQPGYMVPAGPYGGVVPGPLYPQQWSGMPSPVGMMGAAGGMPYPTMANPGVQAYP
LTLHSPENVPNTRTT
NT seq 8688 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgggtaccgagcacgatggatttaaatatccatctgttcccaattcacaatgt
gatctcaacataaatatttatgagaccatcagcgacggaaacatcaataatatgggcact
tcgacagtcgtgagaggtgggagcgacccaagttcgtatcctccatcgaattatcagctg
atagtacgtcaaagattcatcaggagaagtttgtggttctcggactcggatgaacaggcc
tttgaggtgccagaatgtgacaacagcagtaaaatcctcaacataaacctgcgcacgata
gttgacaggacacggggggcttggtcggggccacaggagggctccagcaccgagagtcaa
ggggggcagaaagacagcgccacagagagtgccagcgctgatgagaaggagaaagctggg
gatacattgaacgttgcatccaccgacggcagtaaaaatgctatcagaactgccagcgat
gagaacgaggaagaggccgaaatgaaagctgtttccacatcccctgggggacggtttctc
aagtttgatattgagctcgggagagggtccttcaagactgtctataaaggmctggatacc
gacacttgggtggaagttgcctggtgtgaacttcaggaccgtaagctgaccaaagtagag
cgtcagcggtttaaggaggaggcagagatgctgaaggggctgcagcaccccaacatrgtc
cgcttctacgacttttgggagtcacccctcaaagggaagaagtgcatcgtcctggtaacg
gagctcatgacctcaggcacgctcaaaacgtatctgaagcgcttcaaggtaatgaagccc
aaggttctgaggagctggtgtaggcagatcctgaagggccttcacttcctccacaccagg
gcccctcccatcatccacagagacctgaagtgtgacaacatcttcatcacgggccccacc
ggctccgtcaagataggagacctggggttggccacgctcaagagggcctccttcgccaag
agtgtcataggcaccccagagttcatggccccagagatgtatgaggagcactatgatgag
tcagtggatgtctatgcctttgggatgtgcatgttggagatggccacctcagagtacccg
tactcggagtgccagaacgctgcacagatctaccgcaaagtcaccagcggggtgaagcct
gccagctacaacaaggttgtggatcctgaaatcaaggagattattggcgagtgcatctgc
cagaagaaagaggagcggtactccataaaggacctgctgaaccacgccttctttgcggag
gacacaggggtgcgggtggagctggccgaggaggatgatgggaagaaggcggccatcgcc
ctgaagctgtgggtggaagacccaaagaagctgaagggaaaatacaaggagagcggagcc
attgagtttacctttgaactggaaaaagagagctcggagggcgtggcccaagagatggtg
gaatcagggttcttccatgagagtgatgctaagatcgtggggaagtcgatccgggaccgc
gtagcactgattaaatggaggcgggagaggaccgtgtcggcccgactcccagtgaaccag
ggagaggcaggactcagggcccaggccaccctagcccaggggacctctgctggggctaca
cgggcaggacagccctctttgattgaggccaacgagccagaggcagaccagcacgccagg
ctatgtaaccctccggccagcgcaacctctgtcacatcagacagcacctttgacagcggc
ctgggctccactgtgttttctgactcccacagcagccagcacaatgtcctctaccagtcc
caagtggagtccgtcaccatgtcaacgcagcagcgtcagtgtttggcttcagcacgtccc
cggtcctgtgaacggggcgaggggtggaaagcagccctggggccggagttccgagtgggt
gcagggacacggagagggagtgcctcggtcattgacactctgaggggcaacaacgacatc
cctcttcatatgctcctgcaacctattacctctgggtcctgcagccaacagagagcttcc
agtcccgcccccacatcaccagacgaccagtcagagagcagcccctctgagtcccgctct
gaggacggcttcccttccccgagtgcatttcctacccccatcctcctggcccccccatcc
cccacgtactctgaggcccgacgtcatagtgactcttctatagaatctccgacgttggaa
gccaccaatggaagcaggttgaagtcagtggaggcagcagtggggcggaggcactcggac
cttagcacgctgcagagcctaaactctgcccttcaacaccaccatcatcaccaaggcgcg
cccagaaaccacctgtgccaggcctgcctctctctgctgctgctgaagtcacgagagggg
gggcacaagaagcacactgcttttccctttccaccacacccttgtgcttgcccccaccgg
caccaccacttctccagtgggatgacaacaactgcagggtcaggagggatgaaaggtcca
agtcatacaggaagtgacttctctgacctctccttactacaaaagaacctgatgaacatc
atcagccgtaaaaccaccccatccaaccagggccaagcctccctcctccacctgcctgca
gcccagcagcctgtacggagctatggggatggtagtctgaagttaacccagagaggcagc
ttcagtggtgaccacacagcaccccccctagccaggcccacacaggaccacaaggccagc
tactgtgctggggagcaccaagccaccgggcctccgggagtgcccagtgctgtgcatgca
ttgctccagaaccagtcatctctccagggccagcctgcctctgccccatccctgtacacg
cccctgcagtacctccagcctggccacagctatcccgccagtcccctggcagcccaacag
acacctaccgcagccggctactcagctgcagctctacaacacagcccagcctcagcaact
tactcagcatcaaacattcctctgcaacataaccatactgyacatagctacccagctcca
gctctgcaaaagatagcaacagcagcaagtcattcaactgcaaatgtaccacttcaacag
cctgcagcaagcttttcagcagctaccctgcccctgcaacagccacacactgcagcaact
atgccaatccaacagacaccaactccacagagctacgttgccccaactcagcaacaaatt
actcaaactgctgcaagctacccaggtccaattctgcaacagaccccaacagcagcaagc
ttctcagcagcagtagccatgcctgtccaacatactgtattggcagctagcataggaact
gcaacaataccctcacaaccagctgcacagagttacccagctccagtggagcgtctgcga
catcccgctcccccacagagctatgcatctgtagccccaactgtggtccacaccgtacat
atacccagtctccctactcaggctcccaatgtcgcaacacagcctccagctgctgctgcg
cttcccccagtccagccttgcccagcgccacacagcctcccagccacagccatgcctctc
agtctgcagccaggccagtctagtcccatgcatcacagccaacagactgtgccggtcccc
attcaacagcaacatagccagccaatgcaccagccctcagcacaacacagccaacagcct
gtgcaggcctccattcagcagcacaaccagcaaactgtgcaggtcccactacccaaaaac
agccagacaatggcccagcccactgtccaacaggctccagtcgtccagagctatcagtca
cctgcccatgctgtgcagcaaggttcaaccctccagagttaccccaacgctgcaccccta
atggggcaaccgaacgctgcttcacagagctacccacccacagccccacacataaaacaa
caggctgcaccggtacaaggctacacgccaacgaaacccagtgcgatgggtcaggcctat
ccatctgctctgactccacagcaggctgcagcccctcagacctacccagtggcccccata
gtgcaacaacagactgggactgccactccacagcacagccaggcccaggcagctacacta
ccactaggccaacagaattttcctgctgctcaaagcctttcccagctccaccaatcatca
tctagtctgccttcccaggcatcgccgcctcagcagctattggctcaggcctctgtccct
cagcagctgcagccactgcagatctccacctctctgccaccaacacaccttccccagttc
tcctcaccgtatcccaacattcaagtggtgacctctctgactggatgtgacatctaccct
cacccctgctctgttccccagtcctacccctcctctctgccccctctctacctctcccca
ggccagcctgccactctgcccccctctgtctcgccccttgcccccctgcatatagggaac
gctctggtgccacccacctctgtgtccttgataccctcacccacaaccctgctggccatg
gcaacacccacactgccacagcacctgcagatgtaccctgctgttttgcaacagagtgtt
atgacacacacacaccctcacacacagctccccactctcacacacccggttcactcacac
cttgcctcactgcctggacaacagaacacaaaaccgcagaatacacaccacatgcaccca
aaccctgctgctgtacgcctaccttttcaacacgtcacacaccctacatactcacaccct
actgctgcacctgaacttgctctgcccagctttctgcccttaagacagcaggtccagcag
caggccaaggcccagcttccagatgccgtcccctttgcacaggctaatcagccttcccag
cctgcagttttctcccctccaatacagactgtgccggaccctggcacaggtactgccgca
acccagcttgacctcatccagaaccccagccaaacccagtcccagcatcaggcccaaggc
cagagccaaccacaggctccagctccactaccccctgactcccagacagcagccccttgg
cctgccagcaccagcctgactcagcagaaccaggccagtgccagcagctgctcagggacc
acactcacctcgggacaggctcaaacagagtccaatctggaggatcctggtgcagagaag
caggcttcaggggccagctactcctacgacagtgtgaactccgacgccacctcagggaag
gagatgagcgacggtaacgaggggacgcacggatcagggaagggcgaggggaaggtccgg
aaacaccaccgccgctccacgcgcacccgctcacgccaggacaagatcaacaagcccaaa
ctcagcatgctcaatgtgtgttatacaggggataagatggtggagtgtcagctggagaca
cacaaccacaagatggttaccttcaagttcgacctggacggagacgcacctgaggagata
gccacttacatggtggagaacgacttcatcctgctcctggagaaggagatgtttatagag
cagttaaaggatattgtggacaaggctgaggacatgctgagtgaggacacggagggggaa
aggatctctgaccacgtgggcagtccccagcagagccacggagcagtcatactgggggga
gagggttcaaagacggctacacctaattcaccacaacttgtgtaccagcagaacgtcctc
cacactgggaagcgctggttcatcatctgccccgtggccgagacgcccacgccagacaga
gagaggacttcatcagacacctctacaaccaaggaggctcctgtcacatcattgtctagg
tccagttgcagtactactccgccagtgtctgccccaactcctgttcttgccctgaccacc
acatcccctactccaggcccctctgcacctcaaagctctgcccagtctcaggacaccaat
gtgggcaaggccagagttcagcagccccaggcctctggaaccaaaccctccaccaccagt
gctacggctgctgccatgggccgccgcaactctctttcaggcagcgaaccctgcatctcc
atggtaacagacatcccatgctgccccatcggcccacctgtgtccctggatgtgaatggg
gcgggacataaagggatgagtggcacttcctcatgtctacccaatcaggaggccagcctg
tcaggagacccgccccctcccctgggctcccaccagccagtggtcctgcagcagccctat
gccatgcaaagcatggtgggtggaggaggtggagccacaacaccatcacagccccagagt
cccgcccaccaggcgtcccagcagcaggatggacctggggggtctgggagtggaggtggt
tgcggcctgggggagtctgatggagagggcccacccagggtagagtttgtggaccgtacc
atcaagactctggatgagaagctgaggaacctgctgtaccaggagtacacccaatctgct
ccttccagcaccgcctcagacctccagggctccatcacagagggggtcagctctccccct
gtctctgactgccagaccacctctgggggggggctccccaggaagggagaggtgctgcct
cagattcctgagcgtactgatagtttgggtacactgagtgactccgcaggattgttgayt
aggagagactgtgtgggcagttccagttcctacgtctccaagagccgctttcagatcatc
cccactcctccggacgtcatccgtcgtttagagaacagcagaagtggcagctcrccggct
ccctctagtggtttggtgggctctcgcgccgcagccgaggggggcggcccacgagaccag
gggtgtatggtcgtgggtaggttctcagtgatgaccactgaagagggtgcggaaaacgcg
cccaaacccccttgtagtaaccgctactcagcccccccagacttgtaccaggacaccacc
gcctctagccccaacgccacccccagcctgcgcccacgtgcccacactgctgacgctgcc
accaaccactcctttcacttcgactctgactcgggggaggaggacaccagtagtttagcc
cctccccttgcctaccacaagactccggctcatgccctcccggaacacagcggaagtgac
ctcatgaagagggcggtggccttcctgcgccgcactcgccgcagcagtgtgcagagctcg
gattcgccgagccggcaatgcgtggtagctaatggccacgccatctcgccgcctggaccc
ggccatgtatcatacgtcagcagtgacaacgactctgagtttgaggatgcggacatgagg
aaggagctgcagaggctgagggagaaacacatgaaggagatctctgagctgcaggcgttc
cagaggagtgagatagagcgtctgtataaagagctggggaaagcactgccgcctggtgta
ggccagctgcacgctgcgccccctagtggccgcagacgcaaggtcagcaaacacaagctg
aaggcaggcaagctgctcaaccccatggtgcagcagctgaaaaacagcctgaataccacc
accactgtatttctctctgaaggtgagagcgcaccgagctcgtctggctctccagctaag
agctccattgtgtctgacggctcggcccgctccagtggcagcagcagcagtaccagrggc
actcggcccagcaaggccccagagcctgtccagacccagcagccctgctctctcaagggc
tcgttctcttctgacaacatctacggtggaggcatggccacacacgtaggcccagggcaa
ggctggacggtataccaccaaacgtcagagagagtgacctataaatctagtagcaaacca
cgcgctagattcctcagtggacccgtgtctctgtccatctggtccacactgaaacgacta
tgtctaggcaaagagcgcagtagtaggtcttctcacggcgccagtgcaactcagacggca
tccaatcagcaacagccaccagctgttcccaatcctttgccatctcctcaaccaatgacg
gtgctagctcaggcccaggcaaacaacagcaacaacaagaagccaggcactttcacggac
gacctgcacaagctggtagatgattggacgaaggagacgctggcggccacacagccgcgg
ccctctctgaaccagatcaaacagcagagacgcatgcaggacctggaggggcaagccacg
cccctgggaggagccacgcaggaggtgagatgtcccatccctccaaacaagttccagctg
cctttgtcgtgcccgctgacagctgctttaggcccagccatgcccactgccctgagctcc
aacccctctgccatgctccagcccgggtacatggtaccagcaggcccctacggaggggtg
gtgcccggccccctatacccccagcagtggtctggtatgcccagccctgtggggatgatg
ggggcagcgggaggaatgccctaccccaccatggccaacccaggggtgcaggcctacccc
ctgaccctgcacagccctgagaacgtccccaacaccaggactacctaa

DBGET integrated database retrieval system