KEGG   Salarchaeum sp. JOR-1: FQU85_05105Help
Entry
FQU85_05105       CDS       T06128                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
salr  Salarchaeum sp. JOR-1
Brite
KEGG Orthology (KO) [BR:salr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    FQU85_05105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: QDX40303
UniProt: A0A518SA90
Position
complement(788806..789963)
Genome map
AA seq 385 aa AA seqDB search
MAGLAVLVVAAVASLFMAWAIGAGSSGSTPFAPAVGANAIPVMRAGFLVGILGFAGAVFQ
GKNVSEAVGQDLIIGQSLSPTAAVIALTIAAVLVAVGVFTGYPIATAFTVTGAVVGTGLA
MGGSPAWAKYQQIATLWVLVPFVGGGIAYATARALRGLDRDRVVISVLGGVVGVIVANVK
FVFLGPSGVSRSLSAAVTPGLPGRAAVSMGVAALVALALYREISRNRARGQRRFLLALGS
LVAFSAGGSQVGLAVGPLLPLVGGDVPITYVLVGGGIGLLAGSWTGAPRMIKALSQDYSS
LGPRRSIAALIPSFAIAQVAVFFGIPVSFNEIIVSAIVGSGYAATGAGGGVSKRKMVFTV
LAWVGSLGLALAASYGAYLGVDAVI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtctcgccgttctggtcgtcgccgccgtcgcgagcctcttcatggcgtgggct
atcggcgcaggctcgtctgggtcgacgccgttcgcgccagcggtcggtgcgaacgcgatt
ccggtgatgcgcgcggggttcctggtcggtatcctcggattcgccggcgcggtgttccag
ggcaagaacgtgagcgaagccgtgggccaagacctcatcatcgggcagtcgctctcgccg
acggcggcggtcatcgcgctcaccatcgccgcggtgctcgtcgcagtcggcgtgttcacg
ggctaccccatcgccaccgcgttcaccgtcacgggcgcggtcgtcggcacgggcctcgcg
atgggcggcagtcccgcgtgggcgaagtatcagcagatagcgacgctctgggtgctcgtg
ccgttcgtcggcggcggcatcgcgtacgccaccgcgcgggcgctccgcggcctcgaccgt
gaccgcgtcgtcatctccgtccttggcggcgtcgtcggcgtcatcgtcgcgaacgtgaag
ttcgtcttcctcggtccgagcggcgtgagccggtcgctctccgccgcagtcacgcccgga
ctcccgggtcgcgccgccgtttcgatgggcgtcgccgcgctcgtcgcactggcgctctac
cgcgaaatcagccggaatcgcgcgcgcggccagcgccgcttcctcctcgcgctcggcagc
ctcgtcgcgttcagcgccggcggcagtcaggtcggcctcgcggtcggcccgctcctcccg
ctcgtcggcggggacgtccccatcacgtacgtgctcgtcggcggcggcatcggactgctc
gccgggtcgtggaccggcgcaccccgaatgataaaagcgctcagccaggactactccagc
ctcggcccgcgccgcagtatcgcggcgctcatcccgagtttcgccatcgcacaggtcgcc
gtgttcttcggcatccccgtctccttcaacgagatcatcgtctcagccatcgtcggcagc
ggatacgccgcgacgggcgcgggcggcggcgtgagcaagcggaaaatggtgttcaccgtg
ctcgcgtgggtcgggtcgctcggtctcgcgctcgccgcgagctacggcgcgtacctcggt
gtcgacgccgtcatctag

DBGET integrated database retrieval system