KEGG   Salarchaeum sp. JOR-1: FQU85_05715Help
Entry
FQU85_05715       CDS       T06128                                 

Definition
(GenBank) malate synthase
  KO
K19282  bifunctional (S)-malyl-CoA lyase/thioesterase [EC:4.1.3.24 3.1.2.30]
Organism
salr  Salarchaeum sp. JOR-1
Pathway
salr00630  Glyoxylate and dicarboxylate metabolism
salr01100  Metabolic pathways
salr01120  Microbial metabolism in diverse environments
salr01200  Carbon metabolism
Module
salr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:salr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    FQU85_05715
Enzymes [BR:salr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.30  (3S)-malyl-CoA thioesterase
     FQU85_05715
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     FQU85_05715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI GP24_25 Ntox5
Motif
Other DBs
NCBI-ProteinID: QDX40420
UniProt: A0A518SAK0
Position
complement(899149..900459)
Genome map
AA seq 436 aa AA seqDB search
MTDPTDRHYDREFVRSFFTSPTAVDGEDDSAKMLRRAAQLRGLEAPDVWVPDNEDATAPS
MRDEGARNIAEVVSEHGADFPGEIHPRVVWHRDSPETRYRGFQHMLEIADPENGAVEHID
GFVIPEVGDLDDWKKADEFITIVETEHGLEPGSLSMSVIIESGEAELAMSDLRAELGNPS
NNLERMFLLVDGEVDYTKDMRAMTPTGELPEWPELRHNTSRGASAAGLVAVDGPYDDIRD
VAGYRERMEENRAKGMTGIWSLTPGQVVEANTAPLPPESGQWLLDDGGDEVELDAQGGRQ
IYRGDRLELEETDTGYELEIGGEERELDADELREELLNRASYVPSMDDIVDSMEQFEAAK
EAGTGAIAMTREATIEVDGVTVDIENDRMWDEATYQAAKTPITLFQDVYEHRPDQHDELA
ERYSEDVVERAAAVGE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgactgatccgacagaccgccactacgaccgcgagttcgttcggtcgttcttcacgagt
ccgacggcggtggacggcgaggacgactccgcgaagatgctgcggcgcgccgcccagctc
cgcggcctcgaagcgcccgacgtgtgggtgccggacaacgaggacgcgaccgccccctcg
atgcgtgacgagggcgcgcggaacatcgcggaggtcgtttcagagcacggcgcggacttc
cccggcgaaatccatccgcgggtcgtctggcaccgcgacagccccgaaacccggtaccga
gggttccagcacatgctcgagatcgccgaccccgagaacggcgcggtcgagcacatcgac
gggttcgtcattcccgaggtcggcgacctcgacgactggaagaaggccgacgagttcatc
accatcgtggagaccgaacacggcctcgaacccggcagcctctcgatgtccgtcatcatc
gagtccggggaggccgaactcgcgatgagcgacctccgcgctgaactcgggaacccgagc
aacaacctcgaacggatgttcctgctcgtggacggcgaggtcgactacacgaaggacatg
cgggcgatgacgcccaccggcgaactccccgagtggcccgagttgcggcacaacacgtcc
cggggcgcgagcgccgccggcctcgtggccgtggacggcccctacgacgacatccgggac
gtcgcgggctaccgcgagcggatggaggagaaccgcgcgaagggcatgaccggaatctgg
tcgctcacgcccggacaggtcgtcgaggcgaacacggccccgctcccgccggagtccggc
cagtggctgctcgacgacggcggcgacgaggtcgaactcgacgcgcagggcggccgccag
atctaccggggcgaccgcctcgaactcgaggagacggacacgggctacgagctcgaaatc
ggcggcgaagaacgcgagctcgacgcggacgaactccgtgaggaactgctcaatcgggcg
tcctacgtcccgagcatggacgacatcgtggactcgatggagcagttcgaggccgcgaag
gaagccggcaccggcgcaatcgcgatgacgcgcgaggccaccatcgaggtggacggcgtg
accgtggacatcgagaacgaccggatgtgggacgaagccacctatcaggcggcgaagacg
cccatcacgctgttccaggacgtgtacgagcaccgccccgatcagcacgacgaactcgcg
gagcggtacagcgaggacgtcgtggagcgcgcggccgcggtcggcgagtaa

DBGET integrated database retrieval system