KEGG   Streptomyces albus DSM 41398: SLNWT_0593
Entry
SLNWT_0593        CDS       T03823                                 

Definition
(GenBank) 2-epi-5-epi-valiolone-7-phosphate 2-epimerase
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
sals  Streptomyces albus DSM 41398
Pathway
sals00525  Acarbose and validamycin biosynthesis
sals01100  Metabolic pathways
sals01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sals00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    SLNWT_0593
Enzymes [BR:sals01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     SLNWT_0593
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: AJE80969
UniProt: A0A0B5EHU5
Position
755366..756157
AA seq 263 aa
MALAEWRLPASGPEALRLARTVGADGLQLDLGGPGRGEWLDGPGRIDAVRAEAESTGVRL
LAVAGNHLNDVGLMSPAARPVLERLLDTAAALAVPLAFVPSFRRSAIEAPADLERTAEVL
AWAAGEAGARGLLLASENVLTGEQARALVRRVGSPAFRVVLDTFNPVAAGLSPEVLVAEL
HDVLADQVHLKDGPPTTGATPPLGSGTGRLDDTLRALRAHQVPVRAAVLENDYRDGDRAR
LLADLRWARQRTASLATTSGKEE
NT seq 792 nt   +upstreamnt  +downstreamnt
ttggccctcgccgaatggcggctgcccgcctcggggcccgaggcgctgcggctggcccgg
acggtcggagccgacggtctgcaactggacctcggcgggcccggccgcggcgagtggctc
gacgggcccggccggatcgacgcggtgcgcgccgaggcggagtcgaccggagtgcggctg
ctcgcggtcgccgggaaccacctcaacgatgtcggcctgatgtcaccggccgcgcgcccg
gtcctggaacgcctcctggacaccgccgccgcgctcgctgtgccgctggccttcgtgccc
agcttccgccgcagcgcgatcgaggcaccggccgacctggaacgcaccgccgaggtgctg
gcctgggccgccggagaggccggggcccgcggtctcctcctggcgagcgagaacgtgctg
accggcgagcaggctcgcgcgctggtccggcgggtcggctcccccgccttccgcgtggtg
ctcgacacgttcaacccggtcgcggccgggctgtcccccgaggtgctggtcgccgaactg
cacgacgtcctggccgaccaggtccacctcaaggacggcccgccgaccaccggcgcgacc
ccgcccctgggcagcggcaccggacggctcgacgacaccctccgtgcgctgcgcgcgcac
caggtgccggtgcgggccgcggtcctggagaacgactaccgcgacggcgatcgggcccgg
ctgctcgccgatctgcgctgggcgcggcagcgcaccgcctcactcgccacgacctcgggg
aaggaagaatga

DBGET integrated database retrieval system