KEGG   Streptomyces albus DSM 41398: SLNWT_1706Help
Entry
SLNWT_1706        CDS       T03823                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
sals  Streptomyces albus DSM 41398
Pathway
sals00511  Other glycan degradation
sals00600  Sphingolipid metabolism
sals01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sals00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SLNWT_1706
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SLNWT_1706
Enzymes [BR:sals01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SLNWT_1706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: AJE82082
UniProt: A0A0B5EVH3
Position
2196591..2198225
Genome map
AA seq 544 aa AA seqDB search
MTLPRRARRPRALAAALLVLLALGGALTASEHGVPRAVGEPVTVWLTTTDDKGGRHVVRG
LEKQRPFVFREGTGGPGVRLGVDEHSRFQPFTGGGASFTDSAAWLLNSSGALPRATREKV
MRRLFSPEDGIGLSFLRNPMGASDLARYPYSYDDLPEGKSDPDLSGFSLRHDLADVVPLT
RQALRLNPELTVMASPWSAPGWMKDSGKLRGGWLNARYYGTYARYFVKYLRGYRDQGIPV
RYVTVQNEPTCCAGYPSMSWSGTSLHYFTKEELLPRLKAAGLSTKVLAHDWNWNTYQKYG
APTVDDPEVRRHPNFGGVAWHGYGSGIDRQQRTHSRYPGLPAFGTEHSGGDWVDDQQSAD
MHDIIDYSRNWARSVTKWSLALDQDQGPHSGGCGVCTGLVTVHHGDGQPGRVEYTVEYYT
MGHLTKFVRPGARRIASTASEAVPNVAWRNPDGSKALIAYNESRRPRTVTLDWGGAHATY
TLPGRTSATFTWSGAQGAAPPALGEEERRGGTGALAPRPAARRGRRAAGRRAQSVGSTPA
RSSP
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttccccgccgcgcgcgccgcccgcgtgccctcgccgccgccctgctcgtgctg
ctcgcgctgggcggggcgctgaccgcctcggagcacggggtgccccgggcggtcggcgaa
ccggtgacggtctggctgaccaccaccgacgacaagggcgggcggcatgtggtgcgcggc
ctggagaagcagcggcccttcgtcttccgggagggcaccggcggccccggggtgcggctc
ggcgtcgacgagcacagccgcttccagcccttcaccggcggcggcgcctccttcaccgac
tccgccgcctggctcctgaactccagcggcgcgctgccccgggccacccgcgagaaggtc
atgcgccggctcttctcccccgaggacggcatcggcctgtccttcctgcgcaatccgatg
ggcgcctccgacctcgcccgctacccgtactcgtacgacgacctgcccgaggggaagagc
gatccggacctctccggcttctcgctgcggcacgatctcgccgatgtggtcccgctgacc
cggcaggcgctgcggctcaacccggagctgaccgtcatggcctcgccctggtcggcgccg
ggctggatgaaggacagcggcaagctgcgcggcggctggctgaacgcccgctactacggc
acctacgcgcgctacttcgtgaagtacctgcggggctaccgggaccagggcatcccggtc
cgctatgtgaccgtgcagaacgagcccacctgctgcgccgggtacccctcgatgagctgg
tccggcacctcgctgcactacttcaccaaagaggagctgctgccccgcctgaaggccgcc
ggtctctccaccaaggtgctcgcccacgactggaactggaacacctaccagaagtacggg
gccccgaccgtggacgaccccgaggtgcgccgccaccccaatttcggcggggtggcctgg
cacggctacggcagcggcatcgaccggcagcagcgcacccacagccgctatccggggctg
cccgccttcggcaccgagcactccggcggcgactgggtcgacgaccagcagagcgccgat
atgcacgacatcatcgactactcccggaactgggcgcgctcggtcaccaagtggtcgctc
gccctcgaccaggaccagggcccgcacagcggcggctgcggggtctgcaccggcctggtc
acggtgcaccacggcgacgggcagcccggcagggtggagtacaccgtggagtactacacg
atgggccacctgacgaagttcgtccggcccggcgcccggcgcatcgcctccaccgcgagc
gaggcggtgccgaacgtggcctggcgcaatccggacggctccaaggcgctgatcgcctac
aacgagtcccggcggccccggacggtcaccctcgactggggcggcgcgcacgccacgtac
accctgccgggccgcacctcggcgaccttcacctggtccggtgcgcaaggggccgcgccg
cccgcgctcggcgaggaggagcggcggggcggcaccggcgcgctcgcgccccgtccggcc
gcgcggcgggggcggcgggccgccgggcgccgggctcagtcggtgggctcgaccccggcg
cgcagcagcccgtag

DBGET integrated database retrieval system